Myelin Basic Protein, Recombinant, Macaca fascicularis, aa1-304, His-SUMO-Tag (EGM_08965)

Source:, Recombinant protein corresponding to aa1-304 from macaca fascicularis Myelin Basic Protein, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~49kD, AA Sequence: MGNHAGKRELNTEKASTNGETNRGESEKKTNLGELSRTTSEDSEVFGEADANQNNGTSSQDTAVTDSKRTADPKNAWQDAHPADPGSRPHLIRLFSRDAPGREDNTFKDRPSESDELQTIQEDSAATSESLDVMASQKRPSQRHGSKYLATASTMDHARHGFLPRHRDTGILDSIGRFFGGDRGVPKRGSGKDSHHAARTAHYGSLPQKSHGRTQDENPVVHFFKNIVTPRTPPPSQGKGRGLSLSRFSWGAEGQKPGFGYGGRASDYKSAHKGFKGVDAQGTLSRIFKLGGRDSRSGSPMARR, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.