MST1 PrEST Antigen

MST1 PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST96060.100 100 µl

7 - 10 business days*

264.00€
 
PrEST Antigen MST1, Gene description: macrophage stimulating 1, Alternative Gene Names: D3F15S2,... more
Product information "MST1 PrEST Antigen"
PrEST Antigen MST1, Gene description: macrophage stimulating 1, Alternative Gene Names: D3F15S2, DNF15S2, HGFL, MSP, NF15S2, Antigen sequence: PEWYVVPPGTKCEIAGWGETKGTGNDTVLNVALLNVISNQECNIKHRG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 79% Rat gene identity: 79%
Keywords: MST1, D3F15S2
Supplier: Atlas Antibodies
Supplier-Nr: APrEST96060

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "MST1 PrEST Antigen"
Write a review
or to review a product.
Viewed