Lysyl Endopeptidase, Recombinant, Pseudomonas Aeruginosa, aa212-462, His-Tag (PrpL)

Lysyl Endopeptidase, Recombinant, Pseudomonas Aeruginosa, aa212-462, His-Tag (PrpL)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
370681.20 20 µg - -

3 - 19 business days*

786.00€
370681.100 100 µg - -

3 - 19 business days*

1,096.00€
 
Lysine-specific endoprotease. Involved in corneal virulence.||Source:|Recombinant protein... more
Product information "Lysyl Endopeptidase, Recombinant, Pseudomonas Aeruginosa, aa212-462, His-Tag (PrpL)"
Lysine-specific endoprotease. Involved in corneal virulence. Source: Recombinant protein corresponding to aa212-462 from pseudomonas aeruginosa prpL fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~42.4kD, AA Sequence: AGYRDGFGASGSCEVDAVCATQSGTRAYDNATAAVAKMVFTSSADGGSYICTGTLLNNGNSPKRQLFWSAAHCIEDQATAATLQTIWFYNTTQCYGDASTINQSVTVLTGGANILHRDAKRDTLLLELKRTPPAGVFYQGWSATPIANGSLGHDIHHPRGDAKKYSQGNVSAVGVTYDGHTALTRVDWPSAVVEGGSSGSGLLTVAGDGSYQLRGGLYGGPSYCGAPTSQRNDYFSDFSGVYSQISRYFAP, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: prpL, PA4175, Protease IV, EC=3.4.21.50, Lysyl endopeptidase, PvdS-regulated endoprotease
Supplier: United States Biological
Supplier-Nr: 370681

Properties

Conjugate: No
MW: 42,4
Format: Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Lysyl Endopeptidase, Recombinant, Pseudomonas Aeruginosa, aa212-462, His-Tag (PrpL)"
Write a review
or to review a product.
Viewed