KMT5C PrEST Antigen

KMT5C PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST96006.100 100 µl

3 - 8 business days*

264.00€
 
PrEST Antigen KMT5C, Gene description: lysine methyltransferase 5C, Alternative Gene Names:... more
Product information "KMT5C PrEST Antigen"
PrEST Antigen KMT5C, Gene description: lysine methyltransferase 5C, Alternative Gene Names: MGC2705, SUV420H2, Antigen sequence: THKMNVSPVPPLRRQQHLRSALETFLRQRDLEAAYRALTLGGWTARYFQSR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Histone methyltransferase that specifically methylates monomethylated 'Lys-20' (H4K20me1) and dimethylated 'Lys-20' (H4K20me2) of histone H4 to produce respectively dimethylated 'Lys-20' (H4K20me2) and trimethylated 'Lys-20' (H4K20me3) and thus regulates transcription and maintenance of genome integrity (PubMed:24396869, PubMed:28114273). In vitro also methylates unmodified 'Lys-20' (H4K20me0) of histone H4 and nucleosomes (PubMed:24396869). H4 'Lys-20' trimethylation represents a specific tag for epigenetic transcriptional repression. Mainly functions in pericentric heterochromatin regions, thereby playing a central role in the establishment of constitutive heterochromatin in these regions. KMT5C is targeted to histone H3 via its interaction with RB1 family proteins (RB1, RBL1 and RBL2). Facilitates TP53BP1 foci formation upon DNA damage and proficient non-homologous end-joining (NHEJ)-directed DNA repair by catalyzing the di- and trimethylation of 'Lys-20' of histone H4 (PubMed:28114273). May play a role in class switch reconbination by catalyzing the di- and trimethylation of 'Lys-20' of histone H4. [The UniProt Consortium] Mouse gene identity: 88% Rat gene identity: 88%
Keywords: PP7130, SUV420H2, Suv4-20h2, Su(var)4-20 homolog 2, Lysine N-methyltransferase 5C, Lysine-specific methyltransferase 5C, Suppressor of variegation 4-20 homolog 2, Histone-lysine N-methyltransferase KMT5C, [histone H4]-lysine20 N-methyltransferase KMT5B
Supplier: Atlas Antibodies
Supplier-Nr: APrEST96006

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "KMT5C PrEST Antigen"
Write a review
or to review a product.
Viewed