KKLC1, Recombinant, Human, aa1-113, His-B2M-Tag (Kita-kyushu Lung Cancer Antigen 1)

KKLC1, Recombinant, Human, aa1-113, His-B2M-Tag (Kita-kyushu Lung Cancer Antigen 1)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
373923.20 20 µg - -

3 - 19 business days*

644.00€
373923.100 100 µg - -

3 - 19 business days*

858.00€
373923.1 1 mg - -

3 - 19 business days*

2,843.00€
 
Source:|Recombinant protein corresponding to aa1-113 from human KKLC1, fused to His-B2M-Tag at... more
Product information "KKLC1, Recombinant, Human, aa1-113, His-B2M-Tag (Kita-kyushu Lung Cancer Antigen 1)"
Source:, Recombinant protein corresponding to aa1-113 from human KKLC1, fused to His-B2M-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~26.8kD, AA Sequence: MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: CT83, CXorf61, KK-LC-1, Cancer/testis antigen 83, Kita-kyushu lung cancer antigen 1
Supplier: United States Biological
Supplier-Nr: 373923

Properties

Conjugate: No
MW: 26,8
Format: Purified

Database Information

UniProt ID : Q5H943 | Matching products
Gene ID : GeneID 203413 | Matching products

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "KKLC1, Recombinant, Human, aa1-113, His-B2M-Tag (Kita-kyushu Lung Cancer Antigen 1)"
Write a review
or to review a product.
Viewed