INS-IGF2 PrEST Antigen

INS-IGF2 PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST96107.100 100 µl

7 - 10 business days*

264.00€
 
PrEST Antigen INS-IGF2, Gene description: INS-IGF2 readthrough, Antigen sequence:... more
Product information "INS-IGF2 PrEST Antigen"
PrEST Antigen INS-IGF2, Gene description: INS-IGF2 readthrough, Antigen sequence: PVLFIHCPGAAGTAQGLEYRGRRVTTEPVWEEVDSSPQPQGSESLPAQPP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 46% Rat gene identity: 46%
Keywords: INS-IGF2, Insulin, isoform 2, INS-IGF2 readthrough transcript protein
Supplier: Atlas Antibodies
Supplier-Nr: APrEST96107

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Database Information

UniProt ID : F8WCM5 | Matching products
Gene ID : GeneID 723961 | Matching products

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "INS-IGF2 PrEST Antigen"
Write a review
or to review a product.
Viewed