IL11RA PrEST Antigen

IL11RA PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST96192.100 100 µl

3 - 8 business days*

264.00€
 
PrEST Antigen IL11RA, Gene description: interleukin 11 receptor subunit alpha, Antigen sequence:... more
Product information "IL11RA PrEST Antigen"
PrEST Antigen IL11RA, Gene description: interleukin 11 receptor subunit alpha, Antigen sequence: RYLTSYRKKTVLGADSQRRSPSTGPWPCPQDPLGAARCVVHGAEFWSQYRINVTEVNPLGASTRLLDVSLQSILRPDPPQGLRVESVPGYP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Receptor for interleukin-11 (IL11). The receptor systems for IL6, LIF, OSM, CNTF, IL11 and CT1 can utilize IL6ST for initiating signal transmission. The IL11/IL11RA/IL6ST complex may be involved in the control of proliferation and/or differentiation of skeletogenic progenitor or other mesenchymal cells (Probable). Essential for the normal development of craniofacial bones and teeth. Restricts suture fusion and tooth number. [The UniProt Consortium] Mouse gene identity: 90% Rat gene identity: 90%
Supplier: Atlas Antibodies
Supplier-Nr: APrEST96192

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "IL11RA PrEST Antigen"
Write a review
or to review a product.
Viewed