IFT27 PrEST Antigen

PrEST Antigen IFT27, Gene description: intraflagellar transport 27, Alternative Gene Names: BBS19, FAP156, RABL4, RAYL, Antigen sequence: MVKLAAKCILAGDPAVGKTALAQIFRSDGAHFQKSYTLTTGMDLVVKTVPVPDTGDSVELFIFDSAGKELFSEMLDKLWESPNVLCLVYDV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Small GTPase-like component of the intraflagellar transport (IFT) complex B that promotes the exit of the BBSome complex from cilia via its interaction with ARL6 (PubMed:25443296). Not involved in entry of the BBSome complex into cilium. Prevents aggregation of GTP-free ARL6 (PubMed:25443296). Required for hedgehog signaling. Forms a subcomplex within the IFT complex B with IFT25. Its role in intraflagellar transport is mainly seen in tissues rich in ciliated cells such as kidney and testis. Essential for male fertility, spermiogenesis and sperm flagella formation. Plays a role in the early development of the kidney. May be involved in the regulation of ureteric bud initiation. [The UniProt Consortium] Mouse gene identity: 91% Rat gene identity: 91%