ICOS, Fc Fusion, Recombinant, Human, aa21-140 (Inducible T-Cell Costimulator and CD Antigen 278, Act

ICOS, Fc Fusion, Recombinant, Human, aa21-140 (Inducible T-Cell Costimulator and CD Antigen 278, Act
Item number Size Datasheet Manual SDS Delivery time Quantity Price
298414.100 100 µg - -

3 - 19 business days*

561.00€
 
The protein encoded by this gene belongs to the CD28 and CTLA-4 cell-surface receptor family. It... more
Product information "ICOS, Fc Fusion, Recombinant, Human, aa21-140 (Inducible T-Cell Costimulator and CD Antigen 278, Act"
The protein encoded by this gene belongs to the CD28 and CTLA-4 cell-surface receptor family. It forms homodimers and plays an important role in cell-cell signaling, immune responses, and regulation of cell proliferation. [provided by RefSeq, Jul 2008]. Source: Recombinant Fc fusion protein corresponding to aa21-140 from human ICOS at C-terminal, expressed in a HEK293 cell expression system. Molecular Weight: ~40.2kD, runs at a higher MW by SDS-PAGE due to glycosylation, AA Sequence: EINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKS, LKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQ, LKIEGRMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVS, HEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVS, NKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWES, NGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKS, LSLSPGK, Applications: Suitable for use in the study of protein binding and for screening small molecules and antibodies. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. Aliquots are stable for 6 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Keywords: ICOS, AILIM, CD278, Inducible T-cell costimulator, Activation-inducible lymphocyte immunomediatory molecule
Supplier: United States Biological
Supplier-Nr: 298414

Properties

Conjugate: No
MW: 40,2
Format: Highly Purified

Handling & Safety

Storage: -80°C
Shipping: -80°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow. more
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "ICOS, Fc Fusion, Recombinant, Human, aa21-140 (Inducible T-Cell Costimulator and CD Antigen 278, Act"
Write a review
or to review a product.
Viewed