HTT PrEST Antigen

HTT PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST95565.100 100 µl

3 - 8 business days*

264.00€
 
PrEST Antigen HTT, Gene description: huntingtin, Alternative Gene Names: HD, IT15, Antigen... more
Product information "HTT PrEST Antigen"
PrEST Antigen HTT, Gene description: huntingtin, Alternative Gene Names: HD, IT15, Antigen sequence: DWYVHLVKSQCWTRSDSALLEGAELVNRIPAEDMNAFMMNSEFNLSLLAPCLSLGMSEISGGQKSALFEAAREVTLARVSGTVQQLPAVHHVFQPELPAEPAAYWSKLNDLFGDAALYQSLPTLARALAQYLVVVSKLPSH, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: [Huntingtin]: May play a role in microtubule-mediated transport or vesicle function. [The UniProt Consortium] Mouse gene identity: 80% Rat gene identity: 80%
Keywords: HD, HTT
Supplier: Atlas Antibodies
Supplier-Nr: APrEST95565

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "HTT PrEST Antigen"
Write a review
or to review a product.
Viewed