HDAC5 PrEST Antigen

HDAC5 PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST95948.100 100 µl

3 - 8 business days*

264.00€
 
PrEST Antigen HDAC5, Gene description: histone deacetylase 5, Alternative Gene Names: FLJ90614,... more
Product information "HDAC5 PrEST Antigen"
PrEST Antigen HDAC5, Gene description: histone deacetylase 5, Alternative Gene Names: FLJ90614, KIAA0600, NY-CO-9, Antigen sequence: VTVTNSHLTASPKLSTQQEAERQALQSLRQGGTLTGKFMSTSSIPGCLLGVALEGDGSPHGHASLLQHVLLLEQARQQSTLIAVPL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes. Involved in muscle maturation by repressing transcription of myocyte enhancer MEF2C. During muscle differentiation, it shuttles into the cytoplasm, allowing the expression of myocyte enhancer factors. Involved in the MTA1-mediated epigenetic regulation of ESR1 expression in breast cancer. Serves as a corepressor of RARA and causes its deacetylation (PubMed:28167758). In association with RARA, plays a role in the repression of microRNA-10a and thereby in the inflammatory response (PubMed:28167758). [The UniProt Consortium] Mouse gene identity: 99% Rat gene identity: 99%
Keywords: HD5, HDAC5, KIAA0600, EC=3.5.1.98, Antigen NY-CO-9, Histone deacetylase 5
Supplier: Atlas Antibodies
Supplier-Nr: APrEST95948

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "HDAC5 PrEST Antigen"
Write a review
or to review a product.
Viewed