HBZ, Recombinant, Human, aa1-142, GST-Tag (Hemoglobin Subunit zeta)

The zeta chain is an alpha-type chain of mammalian embryonic hemoglobin. Source: Recombinant protein corresponding to aa1-142 from human HBZ, fused to GST-Tag at N-terminal expressed in E. coli. Molecular Weight: ~42.5kD, AA Sequence: SLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGALSKLSELHAYILRVDPVNFKLLSHCLLVTLAARFPADFTAEAHAAWDKFLSVVSSVLTEKYR, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.