Galectin-4, Recombinant, Rat, aa1-324 (Lgals4)

Galectin-4, Recombinant, Rat, aa1-324 (Lgals4)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
517917.20 20 µg - -

3 - 19 business days*

757.00€
 
Galectin that binds lactose and a related range of sugars.||Source:|Recombinant full length... more
Product information "Galectin-4, Recombinant, Rat, aa1-324 (Lgals4)"
Galectin that binds lactose and a related range of sugars. Source: Recombinant full length protein corresponding to aa1-324 of rat Galectin-4, expressed in E. coli. Molecular Weight: ~36.3kD, AA Sequence: MAYVPAPGYQPTYNPTLPYKRPIPGGLSVGMSIYIQGIAKDNMRRFHVNFAVGQDEGADIAFHFNPRFDGWDKVVFNTMQSGQWGKEEKKKSMPFQKGHHFELVFMVMSEHYKVVVNGTPFYEYGHRLPLQMVTHLQVDGDLELQSINFLGGQPAASQYPGTMTIPAYPSAGYNPPQMNSLPVMAGPPIFNPPVPYVGTLQGGLTARRTIIIKGYVLPTAKNLIINFKVGSTGDIAFHMNPRIGDCVVRNSYMNGSWGSEERKIPYNPFGAGQFFDLSIRCGTDRFKVFANGQHLFDFSHRFQAFQRVDMLEIKGDITLSYVQI, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: Gal-4, L36LBP, Lgals4, Galectin-4, Lactose-binding lectin 4, L-36 lactose-binding protein
Supplier: United States Biological
Supplier-Nr: 517917

Properties

Conjugate: No
Host: E.coli
Species reactivity: rat
MW: 36.3 kD
Purity: ?85% (SDS-PAGE)

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Galectin-4, Recombinant, Rat, aa1-324 (Lgals4)"
Write a review
or to review a product.
Viewed