FKBP10 PrEST Antigen

FKBP10 PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST95574.100 100 µl

3 - 8 business days*

264.00€
 
PrEST Antigen FKBP10, Gene description: FKBP prolyl isomerase 10, Alternative Gene Names: FKBP6,... more
Product information "FKBP10 PrEST Antigen"
PrEST Antigen FKBP10, Gene description: FKBP prolyl isomerase 10, Alternative Gene Names: FKBP6, FKBP65, FLJ20683, FLJ22041, FLJ23833, hFKBP65, Antigen sequence: VVGVGRLITGMDRGLMGMCVNERRRLIVPPHLGYGSIGLAGLIPPDATLYFDVVLLDVWNKEDTVQVSTLLRPPHCPRMVQDGDFVRYHYNGT, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: PPIases accelerate the folding of proteins during protein synthesis. [The UniProt Consortium] Mouse gene identity: 91% Rat gene identity: 91%
Keywords: FKBP10, FKBP65, FKBP-65, FKBP-10, PSEC0056, Rotamase, EC=5.2.1.8, 65 kDa FKBP, PPIase FKBP10, Immunophilin FKBP65, FK506-binding protein 10, 65 kDa FK506-binding protein, Peptidyl-prolyl cis-trans isomerase FKBP10
Supplier: Atlas Antibodies
Supplier-Nr: APrEST95574

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "FKBP10 PrEST Antigen"
Write a review
or to review a product.
Viewed