ECM2 PrEST Antigen

ECM2 PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST95917.100 100 µl

3 - 8 business days*

264.00€
 
PrEST Antigen ECM2, Gene description: extracellular matrix protein 2, Antigen sequence:... more
Product information "ECM2 PrEST Antigen"
PrEST Antigen ECM2, Gene description: extracellular matrix protein 2, Antigen sequence: RVLCDETMCHPQRCPQTVIPEGECCPVCSATEQREPTNLLHKQLPPPQVGMDRIVRKEALQSEEDEEVKEE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Promotes matrix assembly and cell adhesiveness. [The UniProt Consortium] Mouse gene identity: 68% Rat gene identity: 68%
Keywords: ECM2, Matrix glycoprotein SC1/ECM2, Extracellular matrix protein 2
Supplier: Atlas Antibodies
Supplier-Nr: APrEST95917

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "ECM2 PrEST Antigen"
Write a review
or to review a product.
Viewed