DUSP26, Recombinant, Human, aa1-211, His-SUMO-Tag (Dual Specificity Protein Phosphatase 26)

DUSP26, Recombinant, Human, aa1-211, His-SUMO-Tag (Dual Specificity Protein Phosphatase 26)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
373110.20 20 µg - -

3 - 19 business days*

603.00€
373110.100 100 µg - -

3 - 19 business days*

889.00€
 
Inactivates MAPK1 and MAPK3 which leads to dephosphorylation of heat shock factor protein 4 and a... more
Product information "DUSP26, Recombinant, Human, aa1-211, His-SUMO-Tag (Dual Specificity Protein Phosphatase 26)"
Inactivates MAPK1 and MAPK3 which leads to dephosphorylation of heat shock factor protein 4 and a reduction in its DNA-binding activity. Inhibits MAP kinase p38 by dephosphorylating it and inhibits p38-mediated apoptosis in anaplastic thyroid cancer cells. Can also induce activation of MAP kinase p38 and c-Jun N-terminal kinase (JNK). Source: Recombinant protein corresponding to aa1-211 from human DUSP26, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~39.9kD, AA Sequence: MCPGNWLWASMTFMARFSRSSSRSPVRTRGTLEEMPTVQHPFLNVFELERLLYTGKTACNHADEVWPGLYLGDQDMANNRRELRRLGITHVLNASHSRWRGTPEAYEGLGIRYLGVEAHDSPAFDMSIHFQTAADFIHRALSQPGGKILVHCAVGVSRSATLVLAYLMLYHHLTLVEAIKKVKDHRGIIPNRGFLRQLLALDRRLRQGLEA, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: MKP-8, DSP-4, LDP-4, DUSP26, DUSP24, EC=3.1.3.16, EC=3.1.3.48, MAP kinase phosphatase 8, Dual specificity phosphatase SKRP3, Dual specificity protein phosphatase 26, Mitogen-activated protein kinase phosphatase 8
Supplier: United States Biological
Supplier-Nr: 373110

Properties

Conjugate: No
MW: 39,9
Format: Highly Purified

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "DUSP26, Recombinant, Human, aa1-211, His-SUMO-Tag (Dual Specificity Protein Phosphatase 26)"
Write a review
or to review a product.
Viewed