DLG4 PrEST Antigen

DLG4 PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST96082.100 100 µl

7 - 10 business days*

264.00€
 
PrEST Antigen DLG4, Gene description: discs large MAGUK scaffold protein 4, Alternative Gene... more
Product information "DLG4 PrEST Antigen"
PrEST Antigen DLG4, Gene description: discs large MAGUK scaffold protein 4, Alternative Gene Names: PSD-95, PSD95, SAP-90, SAP90, Antigen sequence: KVAKPSNAYLSDSYAPPDITTSYSQHLDNEISHSSYLGTDYPTAMTPTSPRRYSPVAKDLLGEEDIPREPRRIVIHR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Postsynaptic scaffolding protein that plays a critical role in synaptogenesis and synaptic plasticity by providing a platform for the postsynaptic clustering of crucial synaptic proteins. Interacts with the cytoplasmic tail of NMDA receptor subunits and shaker-type potassium channels. Required for synaptic plasticity associated with NMDA receptor signaling. Overexpression or depletion of DLG4 changes the ratio of excitatory to inhibitory synapses in hippocampal neurons. May reduce the amplitude of ASIC3 acid-evoked currents by retaining the channel intracellularly. May regulate the intracellular trafficking of ADR1B. Also regulates AMPA-type glutamate receptor (AMPAR) immobilization at postsynaptic density keeping the channels in an activated state in the presence of glutamate and preventing synaptic depression. [The UniProt Consortium] Mouse gene identity: 100% Rat gene identity: 100%
Keywords: PSD95, SAP90, SAP-90, PSD-95, Disks large homolog 4, Synapse-associated protein 90, Postsynaptic density protein 95
Supplier: Atlas Antibodies
Supplier-Nr: APrEST96082

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "DLG4 PrEST Antigen"
Write a review
or to review a product.
Viewed