Disintegrin and Metalloproteinase Domain-Containing Protein 12, Recombinant, Mouse, aa206-706, His-T

Disintegrin and Metalloproteinase Domain-Containing Protein 12, Recombinant, Mouse, aa206-706, His-T
Item number Size Datasheet Manual SDS Delivery time Quantity Price
517874.20 20 µg - -

9 - 20 business days*

738.00€
517874.100 100 µg - -

9 - 20 business days*

1,536.00€
 
Involved in skeletal muscle regeneration, specifically at the onset of cell fusion. Also involved... more
Product information "Disintegrin and Metalloproteinase Domain-Containing Protein 12, Recombinant, Mouse, aa206-706, His-T"
Involved in skeletal muscle regeneration, specifically at the onset of cell fusion. Also involved in macrophage-derived giant cells (MGC) and osteoclast formation from mononuclear precursors. Source: Recombinant protein corresponding to aa206-706 of mouse Disintegrin and Metalloproteinase Domain-Containing Protein 12, fused to 10xHis-Tag at N-terminal and Myc-Tag at C-terminal, expressed in Baculovirus. Molecular Weight: ~58.4kD, AA Sequence: ETLKMTKYVELVIVADNREFQRQGKDLEKVKQRLIEIANHVDKFYRPLNIRIVLVGVEVWNDIDKCSISQDPFTSLHEFLDWRKIKLLPRKSHDNAQLISGVYFQGTTIGMAPIMSMCTAEQSGGVVMDHSDSPLGAAVTLAHELGHNFGMNHDTLERGCSCRMAAEKGGCIMNPSTGFPFPMVFSSCSRKDLEASLEKGMGMCLFNLPEVKQAFGGRKCGNGYVEEGEECDCGEPEECTNRCCNATTCTLKPDAVCAHGQCCEDCQLKPPGTACRGSSNSCDLPEFCTGTAPHCPANVYLHDGHPCQGVDGYCYNGICQTHEQQCVTLWGPGAKPAPGICFERVNSAGDPYGNCGKDSKSAFAKCELRDAKCGKIQCQGGASRPVIGTNAVSIETNIPQQEGGRILCRGTHVYLGDDMPDPGLVLAGTKCAEGKICLNRRCQNISVFGVHKCAMQCHGRGVCNNRKNCHCEAHWAPPFCDKFGFGGSTDSGPIRQADNQG, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Keywords: Mltna, Adam12, ADAM 12, EC=3.4.24.-, Meltrin-alpha, Disintegrin and metalloproteinase domain-containing protein 12
Supplier: United States Biological
Supplier-Nr: 517874

Properties

Conjugate: No
Host: Insect cells
Species reactivity: mouse
MW: 58.4 kD
Purity: >=90% (SDS-PAGE)

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "Disintegrin and Metalloproteinase Domain-Containing Protein 12, Recombinant, Mouse, aa206-706, His-T"
Write a review
or to review a product.
Viewed