CSMD3 PrEST Antigen

CSMD3 PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST95764.100 100 µl

3 - 8 business days*

264.00€
 
PrEST Antigen CSMD3, Gene description: CUB and Sushi multiple domains 3, Antigen sequence:... more
Product information "CSMD3 PrEST Antigen"
PrEST Antigen CSMD3, Gene description: CUB and Sushi multiple domains 3, Antigen sequence: SAPYQGSSTLTHTTSTGELEEHNRTTTGAIAVASTPADVTVSSVTAVTIHRLSEEQRVQVTSLRNSGLDPNTSKDGLSPHPADTQSTRRRP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Involved in dendrite development. [The UniProt Consortium] Mouse gene identity: 82% Rat gene identity: 82%
Keywords: CSMD3, KIAA1894, CUB and sushi multiple domains protein 3, CUB and sushi domain-containing protein 3
Supplier: Atlas Antibodies
Supplier-Nr: APrEST95764

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "CSMD3 PrEST Antigen"
Write a review
or to review a product.
Viewed