Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
| Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
|---|---|---|---|---|---|---|---|
| 517846.20 | 20 µg | - | - |
3 - 19 business days* |
786.00€
|
||
| 517846.100 | 100 µg | - | - |
3 - 19 business days* |
1,096.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
Cold-inducible mRNA binding protein that plays a protective role in the genotoxic stress response... more
Product information "Cold-Inducible RNA-Binding Protein, Recombinant, Mouse, aa1-172, His-Tag (CIRBP)"
Cold-inducible mRNA binding protein that plays a protective role in the genotoxic stress response by stabilizing transcripts of genes involved in cell survival. Promotes assembly of stress granules (SGs), when overexpressed. Seems to play an essential role in cold-induced suppression of cell proliferation. Acts as a translational repressor. Acts as a translational activator. Binds specifically to the 3'-untranslated regions (3'-UTRs) of stress-responsive transcripts RPA2 and TXN. Source: Recombinant full length protein corresponding to aa1-172 of mouse Cold-Inducible RNA-Binding Protein, fused to 6xHis-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~22.6kD, AA Sequence: MASDEGKLFVGGLSFDTNEQALEQVFSKYGQISEVVVVKDRETQRSRGFGFVTFENIDDAKDAMMAMNGKSVDGRQIRVDQAGKSSDNRSRGYRGGSAGGRGFFRGGRSRGRGFSRGGGDRGYGGGRFESRSGGYGGSRDYYASRSQGGSYGYRSSGGSYRDSYDSYATHNE, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
| Keywords: | Cirp, Cirbp, A18 hnRNP, Cold-inducible RNA-binding protein, Glycine-rich RNA-binding protein CIRP |
| Supplier: | United States Biological |
| Supplier-Nr: | 517846 |
Properties
| Conjugate: | No |
| Host: | E.coli |
| Species reactivity: | mouse |
| MW: | 22.6 kD |
| Purity: | ?90% (SDS-PAGE) |
Database Information
| KEGG ID : | K13195 | Matching products |
| UniProt ID : | P60824 | Matching products |
| Gene ID : | GeneID 12696 | Matching products |
Handling & Safety
| Storage: | -20°C |
| Shipping: | +4°C (International: °C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed