COL1A2 PrEST Antigen

COL1A2 PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST96171.100 100 µl

3 - 8 business days*

264.00€
 
PrEST Antigen COL1A2, Gene description: collagen type I alpha 2 chain, Alternative Gene Names:... more
Product information "COL1A2 PrEST Antigen"
PrEST Antigen COL1A2, Gene description: collagen type I alpha 2 chain, Alternative Gene Names: OI4, Antigen sequence: GPPGVSGGGYDFGYDGDFYRADQPRSAPSLRPKDYEV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Type I collagen is a member of group I collagen (fibrillar forming collagen). [The UniProt Consortium] Mouse gene identity: 92% Rat gene identity: 92%
Keywords: COL1A2, Alpha-2 type I collagen, Collagen alpha-2(I) chain
Supplier: Atlas Antibodies
Supplier-Nr: APrEST96171

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "COL1A2 PrEST Antigen"
Write a review
or to review a product.
Viewed