CENPJ PrEST Antigen

CENPJ PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST96236.100 100 µl

7 - 10 business days*

264.00€
 
PrEST Antigen CENPJ, Gene description: centromere protein J, Alternative Gene Names: BM032, CPAP,... more
Product information "CENPJ PrEST Antigen"
PrEST Antigen CENPJ, Gene description: centromere protein J, Alternative Gene Names: BM032, CPAP, LAP, LIP1, MCPH6, Sas-4, SASS4, SCKL4, Antigen sequence: SNILSHEQSNFCRTAHGDFVLTSKRASPNLFSEAQYQEAPVEKNNLKEENRNHPTGESILCWEKVTEQIQEANDKNLQKHDDSSEVANIEERPIKAAIG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Plays an important role in cell division and centrosome function by participating in centriole duplication (PubMed:17681131, PubMed:20531387). Inhibits microtubule nucleation from the centrosome. Involved in the regulation of slow processive growth of centriolar microtubules. Acts as microtubule plus-end tracking protein that stabilizes centriolar microtubules and inhibits microtubule polymerization and extension from the distal ends of centrioles (PubMed:15047868, PubMed:27219064, PubMed:27306797). Required for centriole elongation and for STIL-mediated centriole amplification (PubMed:22020124). Required for the recruitment of CEP295 to the proximal end of new-born centrioles at the centriolar microtubule wall during early S phase in a PLK4-dependent manner (PubMed:27185865). May be involved in the control of centriolar-microtubule growth by acting as a regulator of tubulin release (PubMed:27306797). [The UniProt Consortium] Mouse gene identity: 61% Rat gene identity: 61%
Keywords: CPAP, CENPJ, CENP-J, Centromere protein J, LAG-3-associated protein, LYST-interacting protein 1, Centrosomal P4.1-associated protein
Supplier: Atlas Antibodies
Supplier-Nr: APrEST96236

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "CENPJ PrEST Antigen"
Write a review
or to review a product.
Viewed