CENPF PrEST Antigen

CENPF PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST96028.100 100 µl

3 - 8 business days*

264.00€
 
PrEST Antigen CENPF, Gene description: centromere protein F, Alternative Gene Names: hcp-1,... more
Product information "CENPF PrEST Antigen"
PrEST Antigen CENPF, Gene description: centromere protein F, Alternative Gene Names: hcp-1, Antigen sequence: SCWKSENEKLLTQMESEKENLQSKINHLETCLKTQQIKSHEYNERVRTLEMDRENLSVEIRNLHNVLDSKSVEVETQKLAYMELQQKAEFSDQKHQKEIENMCLKTSQLTGQVEDLEHKLQLLSNEIMDKDRCYQDLHAEYE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Required for kinetochore function and chromosome segregation in mitosis. Required for kinetochore localization of dynein, LIS1, NDE1 and NDEL1. Regulates recycling of the plasma membrane by acting as a link between recycling vesicles and the microtubule network though its association with STX4 and SNAP25. Acts as a potential inhibitor of pocket protein-mediated cellular processes during development by regulating the activity of RB proteins during cell division and proliferation. May play a regulatory or permissive role in the normal embryonic cardiomyocyte cell cycle and in promoting continued mitosis in transformed, abnormally dividing neonatal cardiomyocytes. Interaction with RB directs embryonic stem cells toward a cardiac lineage. Involved in the regulation of DNA synthesis and hence cell cycle progression, via its C-terminus. Has a potential role regulating skeletal myogenesis and in cell differentiation in embryogenesis. Involved in dendritic cell regulation of T-cell immunity against chlamydia. [The UniProt Consortium] Mouse gene identity: 69% Rat gene identity: 69%
Keywords: CENPF, CENP-F, Mitosin, AH antigen, Centromere protein F, Kinetochore protein CENPF
Supplier: Atlas Antibodies
Supplier-Nr: APrEST96028

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "CENPF PrEST Antigen"
Write a review
or to review a product.
Viewed