CEMIP2 PrEST Antigen

CEMIP2 PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST95571.100 100 µl

3 - 8 business days*

264.00€
 
PrEST Antigen CEMIP2, Gene description: cell migration inducing hyaluronidase 2, Alternative Gene... more
Product information "CEMIP2 PrEST Antigen"
PrEST Antigen CEMIP2, Gene description: cell migration inducing hyaluronidase 2, Alternative Gene Names: TMEM2, Antigen sequence: GDPSVISVNGTDFTFRSAGVLLLVVDPCSVPFRLTEKTVFPLADVSRIEEYLKTGIPPRSIVLLSTRGEIKQLNISHLLVPLGLAKPAHLYDKGSTIFLGFSGNFKPSWTKLFTSPAGQGLGVLEQFIPLQLDEYGCPR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Cell surface hyaluronidase that mediates the initial cleavage of extracellular high-molecular-weight hyaluronan into intermediate- size hyaluronan of approximately 5 kDa fragments (PubMed:28246172). Acts as a regulator of angiogenesis and heart morphogenesis by mediating degradation of extracellular hyaluronan, thereby regulating VEGF signaling. Is very specific to hyaluronan, not able to cleave chondroitin sulfate or dermatan sulfate (PubMed:28246172). [The UniProt Consortium] Mouse gene identity: 79% Rat gene identity: 79%
Keywords: Transmembrane protein 2, Cell surface hyaluronidase, Cell migration-inducing hyaluronidase 2
Supplier: Atlas Antibodies
Supplier-Nr: APrEST95571

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "CEMIP2 PrEST Antigen"
Write a review
or to review a product.
Viewed