Cellular Retinoic Acid-binding Protein 1, Recombinant, Human, aa2-137, GST-Tag (CRABP1)

Cytosolic CRABPs may regulate the access of retinoic acid to the nuclear retinoic acid receptors. Source: Recombinant protein corresponding to aa2-137 from human Cellular Retinoic Acid-binding Protein 1 fused to GST-Tag at N-terminal expressed in E. coli. Molecular Weight: ~42.5kD, AA Sequence: PNFAGTWKMRSSENFDELLKALGVNAMLRKVAVAAASKPHVEIRQDGDQFYIKTSTTVRTTEINFKVGEGFEEETVDGRKCRSLPTWENENKIHCTQTLLEGDGPKTYWTRELANDELILTFGADDVVCTRIYVRE, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.