CD79A PrEST Antigen

CD79A PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST95654.100 100 µl

3 - 8 business days*

264.00€
 
PrEST Antigen CD79A, Gene description: CD79a molecule, Alternative Gene Names: Ig-alpha, IGA,... more
Product information "CD79A PrEST Antigen"
PrEST Antigen CD79A, Gene description: CD79a molecule, Alternative Gene Names: Ig-alpha, IGA, IGAlpha, MB-1, MB1, Antigen sequence: ALWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Required in cooperation with CD79B for initiation of the signal transduction cascade activated by binding of antigen to the B- cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. Also required for BCR surface expression and for efficient differentiation of pro- and pre-B-cells. Stimulates SYK autophosphorylation and activation. Binds to BLNK, bringing BLNK into proximity with SYK and allowing SYK to phosphorylate BLNK. Also interacts with and increases activity of some Src-family tyrosine kinases. Represses BCR signaling during development of immature B- cells. [The UniProt Consortium] Mouse gene identity: 51% Rat gene identity: 51%
Keywords: IGA, CD79a, CD79A, Ig-alpha, MB-1 membrane glycoprotein, Surface IgM-associated protein, Membrane-bound immunoglobulin-associated protein, B-cell antigen receptor complex-associated protein alpha chain
Supplier: Atlas Antibodies
Supplier-Nr: APrEST95654

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "CD79A PrEST Antigen"
Write a review
or to review a product.
Viewed