CD79A PrEST Antigen

PrEST Antigen CD79A, Gene description: CD79a molecule, Alternative Gene Names: Ig-alpha, IGA, IGAlpha, MB-1, MB1, Antigen sequence: ALWMHKVPASLMVSLGEDAHFQCPHNSSNNANVTWWRVLHGNYTWPPEFLGPG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Required in cooperation with CD79B for initiation of the signal transduction cascade activated by binding of antigen to the B- cell antigen receptor complex (BCR) which leads to internalization of the complex, trafficking to late endosomes and antigen presentation. Also required for BCR surface expression and for efficient differentiation of pro- and pre-B-cells. Stimulates SYK autophosphorylation and activation. Binds to BLNK, bringing BLNK into proximity with SYK and allowing SYK to phosphorylate BLNK. Also interacts with and increases activity of some Src-family tyrosine kinases. Represses BCR signaling during development of immature B- cells. [The UniProt Consortium] Mouse gene identity: 51% Rat gene identity: 51%