CD47, Fc, Recombinant, Human, aa19-139 (Leukocyte Surface Antigen CD47, Rh-Related Antigen, Integrin

CD47, Fc, Recombinant, Human, aa19-139 (Leukocyte Surface Antigen CD47, Rh-Related Antigen, Integrin
Item number Size Datasheet Manual SDS Delivery time Quantity Price
298393.100 100 µg - -

9 - 20 business days*

993.00€
 
This gene encodes a membrane protein, which is involved in the increase in intracellular calcium... more
Product information "CD47, Fc, Recombinant, Human, aa19-139 (Leukocyte Surface Antigen CD47, Rh-Related Antigen, Integrin"
This gene encodes a membrane protein, which is involved in the increase in intracellular calcium concentration that occurs upon cell adhesion to extracellular matrix. The encoded protein is also a receptor for the C-terminal cell binding domain of thrombospondin, and it may play a role in membrane transport and signal transduction. This gene has broad tissue distribution, and is reduced in expression on Rh erythrocytes. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Jul 2010]. Source: Recombinant Fc fusion protein corresponding to aa19-139 from human CD47 at C-terminal, expressed in a HEK293 cell expression system. Molecular Weight: ~40kD, runs at a higher MW by SDS-PAGE due to glycosylation, AA Sequence: QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKST, VPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVS, WFSPIEGRMDPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVD, VSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCK, VSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWE, SNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQK, SLSLSPGK, Applications: Suitable for use in the study of protein binding, screening small molecules and antibodies. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. Aliquots are stable for 6 months after receipt. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Keywords: Aspartyl protease
Supplier: United States Biological
Supplier-Nr: 298393

Properties

Conjugate: No
MW: 40
Format: Highly Purified

Database Information

UniProt ID : Q08772 | Matching products

Handling & Safety

Storage: -80°C
Shipping: -80°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "CD47, Fc, Recombinant, Human, aa19-139 (Leukocyte Surface Antigen CD47, Rh-Related Antigen, Integrin"
Write a review
or to review a product.
Viewed