CCDC169 PrEST Antigen

CCDC169 PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST95859.100 100 µl

7 - 10 business days*

264.00€
 
PrEST Antigen CCDC169, Gene description: coiled-coil domain containing 169, Alternative Gene... more
Product information "CCDC169 PrEST Antigen"
PrEST Antigen CCDC169, Gene description: coiled-coil domain containing 169, Alternative Gene Names: C13orf38, LOC728591, RP11-251J8.1, Antigen sequence: VKTLLLKEELDPLKVSCLETLGFSAAGVAGPENRTCLGQKALWPACLHGSSTLAVCQTHL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 33% Rat gene identity: 33%
Keywords: CCDC169, C13orf38, Coiled-coil domain-containing protein 169
Supplier: Atlas Antibodies
Supplier-Nr: APrEST95859

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Database Information

UniProt ID : A6NNP5 | Matching products
Gene ID : GeneID 728591 | Matching products

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "CCDC169 PrEST Antigen"
Write a review
or to review a product.
Viewed