Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
Recombinant protein corresponding to aa385-479 with two N-terminal Tags, His-Tag and T-7 Tag from... more
Product information "Caspase 8 (CASP8) Recombinant, Human"
Recombinant protein corresponding to aa385-479 with two N-terminal Tags, His-Tag and T-7 Tag from human CASP8, expressed in E. coli (Q14790), Amino Acid Sequence: MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-LSSPQT RYIPDEADFL LGMATVNNCV SYRNPAEGTW YIQSLCQSLR ERCPRGDDIL TILTEVNYEV SNKDDKKNMG KQMPQPTFTL RKKLVFPSD, Predicted Molecular Weight: 14.7kD, Predicted Isoelectric Point: 7.8, Subcellular Location: Cytoplasm, Applications: Suitable for use in ELISA, Western Blot, Immunoprecipitation and SDS-PAGE., Other applications not tested. Recommended Dilutions: Optimal dilutions to be determined by the researcher. Included Protein Molecular Weight Marker: 168631: Unstained Protein Molecular Weight Marker, 10-70kD. No heating, diluting or reducing agents needed., MW: 10kD, 14kD, 18kD, 22kD, 26kD, 33kD, 44kD, 70kD , Double intensity: 10kD, 18kD, 26kD, Supplied in 62.5mM Tris-H3PO4, pH 7.5, 1mM EDTA, 2% SDS, 100mM DTT, 1mM sodium azide, 0.01% bromo-phenol blue, 33% glycerol. Add 3-5ul/well for mini gels, 7ul/well for large gels. Store at -20°C Stable for 6 months after receipt. Storage and Stability: Lyophilized powder may be stored at -70°C. Stable for 6 months after receipt. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer. Note: Thermal stability is described by the loss rate of the target protein. The loss rate was determined by accelerated thermal degradation by incubating the protein at 37°C for 48h, with no obvious degradation or precipitation observed. Protein loss is <5% within the expiration date under appropriate storage conditions.
| Supplier: | United States Biological |
| Supplier-Nr: | 153891 |
Properties
| Conjugate: | No |
| Format: | Highly Purified |
Database Information
| UniProt ID : | Q14790 | Matching products |
Handling & Safety
| Storage: | vT |
| Shipping: | +4°C (International: °C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
Viewed