CALCB, Recombinant, Human, aa1-127, GST-Tag (Calcitonin Gene-related Peptide 2)

CGRP induces vasodilation. It dilates a variety of vessels including the coronary, cerebral and systemic vasculature. Its abundance in the CNS also points toward a neurotransmitter or neuromodulator role. Source: Recombinant protein corresponding to aa1-127 from human CALCB, fused to GST-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~30.8kD, AA Sequence: ACNTATCVTHRLAGLLSRSGGMVKSNFVPTNVGSKAF, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.