C5a, Mouse, Recombinant

C5a, Mouse, Recombinant
Item number Size Datasheet Manual SDS Delivery time Quantity Price
HYC-HC1101-50UG 50 µg -

Request delivery time estimate

573.00€
 
Complement fragment C5a is a 74-residu glycopolypeptide which is generated by proteolytic... more
Product information "C5a, Mouse, Recombinant"
Complement fragment C5a is a 74-residu glycopolypeptide which is generated by proteolytic cleavage of the complement factor C5 in the course of complement activation. C5a is a potent chemoattractant and anaphylatoxin that acts on all classes of leukocytes and on many other cell types including endothelial, smooth muscle, kidney, liver, and neural cells. In addition to its proinflammatory effects, C5a has been shown to protect cells against toxic insult and to stimulate proliferation in neurons and hepatocytes, suggesting a wider role for C5a in homeostasis. C5a is rapidly desarginated by serum carboxypeptidase N to the less potent derivate C5a desArg, the first stage in deactivation of anaphylatoxin activity. The C5a desArg form has a different spectrum of bioactivity to intact C5a. Recombinant mouse C5a is His-Tagged and has the following amino acid sequence: MRGSHHHHHHGSDYDIPTTENLYFQGGSNLHLLRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERVARVTIGPLCIAFNECCTIANKIRKESPHKPVQLGR. The molecular weight of the protein is 12 kg/mol.
Keywords: C5, Complement C5, Hemolytic complement
Supplier: Hycult Biotech
Supplier-Nr: HC1101

Properties

Conjugate: No
Host: E.coli
Species reactivity: mouse
Format: Lyophilized

Handling & Safety

Storage: +4°C
Shipping: +20°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow. more
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "C5a, Mouse, Recombinant"
Write a review
or to review a product.
Viewed