Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
| Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
|---|---|---|---|---|---|---|---|
| HYC-HC1102-50UG | 50 µg | - |
Request delivery time estimate |
573.00€
|
If you have any questions, please use our Contact Form.
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
You can also order by e-mail: info@biomol.com
Larger quantity required? Request bulk
Complement fragment C5a is a 74-residu glycopolypeptide which is generated by proteolytic... more
Product information "C5a des Arg, Mouse, Recombinant"
Complement fragment C5a is a 74-residu glycopolypeptide which is generated by proteolytic cleavage of the complement factor C5 in the course of complement activation. C5a is a potent chemoattractant and anaphylatoxin that acts on all classes of leukocytes and on many other cell types including endothelial, smooth muscle, kidney, liver, and neural cells. In addition to its proinflammatory effects, C5a has been shown to protect cells against toxic insult and to stimulate proliferation in neurons and hepatocytes, suggesting a wider role for C5a in homeostasis. C5a is rapidly desarginated by serum carboxypeptidase N to the less potent derivate C5a desArg, the first stage in deactivation of anaphylatoxin activity. The C5a desArg form has a different spectrum of bioactivity to intact C5a. Recombinant mouse C5a is His-Tagged and has the following amino acid sequence: MRGSHHHHHHGSDYDIPTTENLYFQGGSNLHLLRQKIEEQAAKYKHSVPKKCCYDGARVNFYETCEERVARVTIGPLCIAFNECCTIANKIRKESPHKPVQLG. The molecular weight of the protein is 12 kg/mol. .
| Keywords: | C5, Complement C5, Hemolytic complement |
| Supplier: | Hycult Biotech |
| Supplier-Nr: | HC1102 |
Properties
| Conjugate: | No |
| Host: | E.coli |
| Species reactivity: | mouse |
| Format: | Lyophilized |
Database Information
| KEGG ID : | K03994 | Matching products |
| UniProt ID : | P06684 | Matching products |
| Gene ID : | GeneID 15139 | Matching products |
Handling & Safety
| Storage: | +4°C |
| Shipping: | +20°C (International: °C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
Viewed