C15orf40 PrEST Antigen

C15orf40 PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST96150.100 100 µl

3 - 8 business days*

264.00€
 
PrEST Antigen C15orf40, Gene description: chromosome 15 open reading frame 40, Alternative Gene... more
Product information "C15orf40 PrEST Antigen"
PrEST Antigen C15orf40, Gene description: chromosome 15 open reading frame 40, Alternative Gene Names: MGC29937, Antigen sequence: MPKKAGATTKGKSQSKEPERPLPPLGPVAVDPKGCVTIAIHAKPGSKQNAVTDLTAEAV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 78% Rat gene identity: 78%
Keywords: C15orf40, UPF0235 protein C15orf40
Supplier: Atlas Antibodies
Supplier-Nr: APrEST96150

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "C15orf40 PrEST Antigen"
Write a review
or to review a product.
Viewed