BRD2 (BD1+BD2), Recombinant, Human, aa65-459, His-Tag (Bromodomain Containing 2, RING3, RNF3)

BRD2 (BD1+BD2), Recombinant, Human, aa65-459, His-Tag (Bromodomain Containing 2, RING3, RNF3)
Item number Size Datasheet Manual SDS Delivery time Quantity Price
298345.100 100 µg - -

3 - 19 business days*

916.00€
 
This gene encodes a transcriptional regulator that belongs to the BET (bromodomains and extra... more
Product information "BRD2 (BD1+BD2), Recombinant, Human, aa65-459, His-Tag (Bromodomain Containing 2, RING3, RNF3)"
This gene encodes a transcriptional regulator that belongs to the BET (bromodomains and extra terminal domain) family of proteins. This protein associates with transcription complexes and with acetylated chromatin during mitosis, and it selectively binds to the acetylated lysine-12 residue of histone H4 via its two bromodomains. The gene maps to the major histocompatability complex (MHC) class II region on chromosome 6p21.3, but sequence comparison suggests that the protein is not involved in the immune response. This gene has been implicated in juvenile myoclonic epilepsy, a common form of epilepsy that becomes apparent in adolescence. Multiple alternatively spliced variants have been described for this gene. [provided by RefSeq, Dec 2010]. Source: Recombinant protein corresponding to aa65-459 from human Bromodomain containing 2, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~45kD, AA Sequence: MHHHHHHEVSNPKKPGRVTNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYH, KIIKQPMDMGTIKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQ, KVASMPQEEQELVVTIPKNSHKKGAKLAALQGSVTSAHQVPAVSSVSHTALYTPPPEIPT, TVLNIPHPSVISSPLLKSLHSAGPPLLAVTAAPPAQPLAKKKGVKRKADTTTPTPTAILAPG, SPASPPGSLEPKAARLPPMRRESGRPIKPPRKDLPDSQQQHQSSKKGKLSEQLKHCNGI, LKELLSKKHAAYAWPFYKPVDASALGLHDYHDIIKHPMDLSTVKRKMENRDYRDAQEFA, ADVRLMFSNCYKYNPPDHDVVAMARKLQDVFEFRYAKMPDEPLE, Applications: Suitable for the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. Storing diluted protein is, not recommended, if necessary, use carrier protein (BSA 0.1-0.5%). Aliquots are stable for 6 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Keywords: BRD2, O27.1.1, KIAA9001, Bromodomain-containing protein 2, Really interesting new gene 3 protein
Supplier: United States Biological
Supplier-Nr: 298345

Properties

Conjugate: No
MW: 45
Format: Purified

Handling & Safety

Storage: -80°C
Shipping: -80°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "BRD2 (BD1+BD2), Recombinant, Human, aa65-459, His-Tag (Bromodomain Containing 2, RING3, RNF3)"
Write a review
or to review a product.
Viewed