BAZ1B, Recombinant, Human, aa1335-1450, His-Tag (Bromodomain Adjacent to Zinc Finger Domain 1B, WBSC

This gene encodes a member of the bromodomain protein family. The bromodomain is a structural motif characteristic of proteins involved in chromatin-dependent regulation of transcription. This gene is deleted in Williams-Beuren syndrome, a developmental disorder caused by deletion of multiple genes at 7q11.23. [provided by RefSeq, Jul 2008], Source: Recombinant protein corresponding to single bromodomain, aa1335-1450, from human BAZ1B, fused to His-tag at N-terminal, expressed in E. coli. Molecular Weight: ~14.7kD, AA Sequence: MHHHHHHKRSSRRQSLELQKCEEILHKIVKYRFSWPFREPVTRDEAEDYYDVITHPM, DFQTVQNKCSCGSYRSVQEFLTDMKQVFTNAEVYNCRGSHVLSCMVKTEQCLVALL, HKHLPGHPYV, Applications: Suitable for use in the study of bromodomain binding assays, screening inhibitors, and selectivity profiling. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. Storage and Stability: Aliquot to avoid repeated freezing and thawing and store at -70°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.