ATP13A5 PrEST Antigen

ATP13A5 PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST95842.100 100 µl

3 - 8 business days*

264.00€
 
PrEST Antigen ATP13A5, Gene description: ATPase 13A5, Alternative Gene Names: FLJ16025, Antigen... more
Product information "ATP13A5 PrEST Antigen"
PrEST Antigen ATP13A5, Gene description: ATPase 13A5, Alternative Gene Names: FLJ16025, Antigen sequence: FGFYSKSQYRTWQKKLAEDSTWPPINRTDYSGDGKNGFYINGGYESHEQIPKRKLKLGGQPTEQHFWAR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 72% Rat gene identity: 72%
Keywords: ATP13A5, EC=7.2.2.-, P5-ATPase isoform 5, Probable cation-transporting ATPase 13A5
Supplier: Atlas Antibodies
Supplier-Nr: APrEST95842

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "ATP13A5 PrEST Antigen"
Write a review
or to review a product.
Viewed