ATP-dependent Clp Protease Proteolytic Subunit, Recombinant, Clostridium Botulinum, aa1-194, His-SUM

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins. Hydrolysis of proteins to small peptides in the presence of ATP and magnesium. Alpha-casein is the usual test substrate. In the absence of ATP, only oligopeptides shorter than five residues are hydrolyzed (such as succinyl-Leu-Tyr-, -NHMec, and Leu-Tyr-Leu-, -Tyr-Trp, in which cleavage of the -Tyr-, -Leu- and -Tyr-, -Trp bonds also occurs). Source: Recombinant protein corresponding to aa1-194 from Clostridium botulinum ATP-dependent Clp Protease Proteolytic Subunit, fused to His-SUMO-Tag at N-terminal, expressed in E. coli. Molecular Weight: ~37.5kD, AA Sequence: MSLVPVVVEQTNRGERSYDIYSRLLKDRIIMLSEEVNDTTASLIVAQLLFLEAEDPDKDIHLYINSPGGSITSGMAIYDTMQYIKPDVSTICVGMAASMGAFLLAAGAKGKRYALPNSEVMIHQPLGGFRGQATDIGIHAERILKMKKKLNTILSDRTGKPLEQVELDTERDHFLSAEEAKEYGLIDEVIDKKK, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.