ATP-dependent Clp Protease Proteolytic Subunit 2, Recombinant, Borrelia Burgdorferi, aa1-198, His-ta

Cleaves peptides in various proteins in a process that requires ATP hydrolysis. Has a chymotrypsin-like activity. Plays a major role in the degradation of misfolded proteins. Source: Recombinant protein corresponding to aa1-198 from Borrelia burgdorferi ATP-dependent Clp protease proteolytic subunit 2, fused to His-tag at N-terminal and fused to Myc-tag at C-terminal, expressed in E. coli. Molecular Weight: ~27.2kD, AA Sequence: MTGKEDNDACVLHDKSLKLVLKSRSIVIAGEITKDVSRLFQEKILLLEALDFKKPIFVYIDSEGGDIDAGFAIFNMIRFVKPKVFTVGVGLVASAAALIFLAAKLENRFSLPFARYLLHQPLSGFKGVATDIEIYTNELNKVKKELNNIISKETGQKISKIEKDTDRDFWLDSSAAKKYGLVFEVVETKYQLEEFISA, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. Aliquots are stable for 6 months after receipt at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.