ARHGAP17 PrEST Antigen

ARHGAP17 PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST96178.100 100 µl

3 - 8 business days*

264.00€
 
PrEST Antigen ARHGAP17, Gene description: Rho GTPase activating protein 17, Alternative Gene... more
Product information "ARHGAP17 PrEST Antigen"
PrEST Antigen ARHGAP17, Gene description: Rho GTPase activating protein 17, Alternative Gene Names: FLJ10308, FLJ13219, NADRIN, RICH1, WBP15, Antigen sequence: VPKPRNRPSVPPPPQPPGVHSAGDSSLTNTAPTASKIVTDSNSRVSEPHRSIFPEMHSDSASKDVPGRILL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Rho GTPase-activating protein involved in the maintenance of tight junction by regulating the activity of CDC42, thereby playing a central role in apical polarity of epithelial cells. Specifically acts as a GTPase activator for the CDC42 GTPase by converting it to an inactive GDP-bound state. The complex formed with AMOT acts by regulating the uptake of polarity proteins at tight junctions, possibly by deciding whether tight junction transmembrane proteins are recycled back to the plasma membrane or sent elsewhere. Participates in the Ca(2+)-dependent regulation of exocytosis, possibly by catalyzing GTPase activity of Rho family proteins and by inducing the reorganization of the cortical actin filaments. Acts as a GTPase activator in vitro for RAC1. [The UniProt Consortium] Mouse gene identity: 75% Rat gene identity: 75%
Keywords: RICH1, RICH-1, MSTP066, ARHGAP17, Rho GTPase-activating protein 17, Rho-type GTPase-activating protein 17, RhoGAP interacting with CIP4 homologs protein 1
Supplier: Atlas Antibodies
Supplier-Nr: APrEST96178

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "ARHGAP17 PrEST Antigen"
Write a review
or to review a product.
Viewed