ARHGAP17 PrEST Antigen

PrEST Antigen ARHGAP17, Gene description: Rho GTPase activating protein 17, Alternative Gene Names: FLJ10308, FLJ13219, NADRIN, RICH1, WBP15, Antigen sequence: VPKPRNRPSVPPPPQPPGVHSAGDSSLTNTAPTASKIVTDSNSRVSEPHRSIFPEMHSDSASKDVPGRILL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Rho GTPase-activating protein involved in the maintenance of tight junction by regulating the activity of CDC42, thereby playing a central role in apical polarity of epithelial cells. Specifically acts as a GTPase activator for the CDC42 GTPase by converting it to an inactive GDP-bound state. The complex formed with AMOT acts by regulating the uptake of polarity proteins at tight junctions, possibly by deciding whether tight junction transmembrane proteins are recycled back to the plasma membrane or sent elsewhere. Participates in the Ca(2+)-dependent regulation of exocytosis, possibly by catalyzing GTPase activity of Rho family proteins and by inducing the reorganization of the cortical actin filaments. Acts as a GTPase activator in vitro for RAC1. [The UniProt Consortium] Mouse gene identity: 75% Rat gene identity: 75%