AQP11 PrEST Antigen

AQP11 PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST95758.100 100 µl

3 - 8 business days*

264.00€
 
PrEST Antigen AQP11, Gene description: aquaporin 11, Alternative Gene Names: AQPX1, Antigen... more
Product information "AQP11 PrEST Antigen"
PrEST Antigen AQP11, Gene description: aquaporin 11, Alternative Gene Names: AQPX1, Antigen sequence: RYCTSALWSLGLTQYHVSERSFACKNPIRVDLLK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Channel protein that facilitates the transport of water, glycerol and hydrogen peroxide across membrane of cell or organelles guaranteeing intracellular homeostasis in several organes like liver, kidney and brain (PubMed:24845055, PubMed:24918044, PubMed:31546170). In situation of stress, participates in endoplasmic reticulum (ER) homeostasis by regulating redox homeostasis through the transport of hydrogen peroxide across the endoplasmic reticulum membrane thereby regulating the oxidative stress through the NADPH oxidase 2 pathway (PubMed:31546170). Plays a role by maintaining an environment suitable for translation or protein foldings in the ER lumen namely by participating in the PKD1 glycosylation processing resulting in regulation of PKD1 membrane trafficking thereby preventing the accumulation of unfolding protein in ER. Plays a role in the proximal tubule function by regulating its endosomal acidification. May play a role in postnatal kidney development. [The UniProt Consortium] Mouse gene identity: 65% Rat gene identity: 65%
Keywords: AQPX1, AQP-11, PSEC0027, Aquaporin-11
Supplier: Atlas Antibodies
Supplier-Nr: APrEST95758

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "AQP11 PrEST Antigen"
Write a review
or to review a product.
Viewed