ADGRA2 PrEST Antigen

ADGRA2 PrEST Antigen
Item number Size Datasheet Manual SDS Delivery time Quantity Price
ATA-APrEST95572.100 100 µl

3 - 8 business days*

264.00€
 
PrEST Antigen ADGRA2, Gene description: adhesion G protein-coupled receptor A2, Alternative Gene... more
Product information "ADGRA2 PrEST Antigen"
PrEST Antigen ADGRA2, Gene description: adhesion G protein-coupled receptor A2, Alternative Gene Names: DKFZp434C211, DKFZp434J0911, FLJ14390, GPR124, KIAA1531, TEM5, Antigen sequence: LLRLNISGNIFSSLQPGVFDELPALKVVDLGTEFLTCDCHLRWLLPWAQNRSLQLSEHTLCAYPSALHAQALGSLQEAQLCCEGALELHTHHLIPSLRQVVFQGDRLPFQCSAS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Endothelial receptor which functions together with RECK to enable brain endothelial cells to selectively respond to Wnt7 signals (WNT7A or WNT7B) (PubMed:28289266, PubMed:30026314). Plays a key role in Wnt7-specific responses, such as endothelial cell sprouting and migration in the forebrain and neural tube, and establishment of the blood-brain barrier. Acts as a Wnt7-specific coactivator of canonical Wnt signaling: required to deliver RECK-bound Wnt7 to frizzled by assembling a higher-order RECK-ADGRA2-Fzd-LRP5-LRP6 complex (PubMed:30026314). ADGRA2-tethering function does not rely on its G-protein coupled receptor (GPCR) structure but instead on its combined capacity to interact with RECK extracellularly and recruit the Dishevelled scaffolding protein intracellularly (PubMed:30026314). Binds to the glycosaminoglycans heparin, heparin sulfate, chondroitin sulfate and dermatan sulfate (PubMed:16982628). [The UniProt Consortium] Mouse gene identity: 89% Rat gene identity: 89%
Keywords: Tumor endothelial marker 5, G-protein coupled receptor 124, Adhesion G protein-coupled receptor A2
Supplier: Atlas Antibodies
Supplier-Nr: APrEST95572

Properties

Conjugate: No
Host: E.coli
Species reactivity: human
Format: Solution

Handling & Safety

Storage: -20°C (avoid repeat freezing and thawing cycles)
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "ADGRA2 PrEST Antigen"
Write a review
or to review a product.
Viewed