Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
Close filters
Filter by:
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
from to

Proteins and Enzymes

Proteins are found in every cell and form the basis of all biological processes. As molecular tools, they perform countless vital tasks in the body, for example by transporting metabolites, catalyzing chemical reactions, enabling cell movement or regulating gene expression. We offer a wide range of protein products, including enzymes, recombinant proteins and hormones. These products support researchers in molecular biology, cell biology, biochemistry and other scientific fields and can be used in a variety of applications, such as enzymatic assays, Western blots or protein-protein interaction studies.

Proteins are found in every cell and form the basis of all biological processes. As molecular tools, they perform countless vital tasks in the body, for example by transporting metabolites,... read more »
Close window
Proteins and Enzymes

Proteins are found in every cell and form the basis of all biological processes. As molecular tools, they perform countless vital tasks in the body, for example by transporting metabolites, catalyzing chemical reactions, enabling cell movement or regulating gene expression. We offer a wide range of protein products, including enzymes, recombinant proteins and hormones. These products support researchers in molecular biology, cell biology, biochemistry and other scientific fields and can be used in a variety of applications, such as enzymatic assays, Western blots or protein-protein interaction studies.

Filter
10593 from 10999 pages
No results were found for the filter!
RNASEL PrEST Antigen
RNASEL PrEST Antigen

Item number: ATA-APrEST96189.100

Atlas Antibodies
PrEST Antigen RNASEL, Gene description: ribonuclease L, Alternative Gene Names: PRCA1, RNS4, Antigen sequence: IKTRKSESEILRLLQPGPSEHSKSFDKWTTKINECVMKKMNKFYEKRGNFYQNTVGDLLKFIRNLGEHIDEEKHKKMKLKIGDPSLYFQKTFPDLVIYVYTKLQNTEYRKHFPQTHSPNKPQCDGAGGA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles....
Keywords: RNS4, RNASEL, RNase L, EC=3.1.26.-, Ribonuclease 4, Ribonuclease L, 2-5A-dependent RNase, 2-5A-dependent ribonuclease
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
TAGLN PrEST Antigen
TAGLN PrEST Antigen

Item number: ATA-APrEST96196.100

Atlas Antibodies
PrEST Antigen TAGLN, Gene description: transgelin, Alternative Gene Names: DKFZp686P11128, SM22, SMCC, TAGLN1, WS3-10, Antigen sequence: KNDGHYRGDPNWFMKKAQEHKREFTESQLQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Actin cross-linking/gelling protein. Involved in calcium...
Keywords: SM22, TAGLN, SM22-alpha, Transgelin, Protein WS3-10, 22 kDa actin-binding protein, Smooth muscle protein 22-alpha
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
H3-3B PrEST Antigen
H3-3B PrEST Antigen

Item number: ATA-APrEST96214.100

Atlas Antibodies
PrEST Antigen H3-3B, Gene description: H3.3 histone B, Alternative Gene Names: H3.3B, H3F3B, Antigen sequence: KPHRYRPGTVALREIRRYQKSTELLIR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Variant histone H3 which replaces conventional H3 in a wide range of nucleosomes in...
Keywords: H3.3B, PP781, H3.3A, Histone H3.3
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
CTNS PrEST Antigen
CTNS PrEST Antigen

Item number: ATA-APrEST96215.100

Atlas Antibodies
PrEST Antigen CTNS, Gene description: cystinosin, lysosomal cystine transporter, Alternative Gene Names: CTNS-LSB, PQLC4, SLC66A4, Antigen sequence: PDEVVVPPGVTNSSFQVTSQNVGQLTVYLHGNHSNQTGPRIRFLVIRSSA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Cystine/H(+) symporter...
Keywords: CTNS, Cystinosin
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
NFIC PrEST Antigen
NFIC PrEST Antigen

Item number: ATA-APrEST96219.100

Atlas Antibodies
PrEST Antigen NFIC, Gene description: nuclear factor I C, Alternative Gene Names: CTF, CTF5, NF-I, NFI, Antigen sequence: QDPLKDLVSLACDPASQQPGPLNGSGQLKMPSHCLSAQMLAPP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Recognizes and binds the palindromic sequence 5'-...
Keywords: CTF, NFI, NFIC, NFI-C, NF1-C, NF-I/C, Nuclear factor I/C, Nuclear factor 1/C, TGGCA-binding protein, Nuclear factor 1...
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
NZY Turbonuclease
NZY Turbonuclease

Item number: NZY-MB49201

NZYtech
NZY Turbonuclease is a highly efficient, recombinant endonuclease derived from the bacterium Serratia marcescens. This enzyme is engineered to exhibit robust nuclease activity, making it an ideal choice for a variety of molecular biology applications where the removal of nucleic acids is required. The enzyme...
Keywords: Recombinant Serratia marcescens endonuclease
Application: Nucleic acid removal
From 199.00€ *
Show details
Review
PE-Labeled Human HLA-A*11:01&B2M&KRAS G12V (VVVGAVGVGK) Tetramer Protein
PE-Labeled Human HLA-A*11:01&B2M&KRAS G12V (VVVGAVGVGK)...

Item number: KT-MHC-HE005TP-100UG

KACTUS
Recombinant PE-Labeled Human HLA-A*11:01&B2M&KRAS G12V (VVVGAVGVGK) Tetramer Protein is expressed from E.coli with His tag and Avi tag at the C-terminus. PE-Labeled Human HLA-A*11:01&B2M&KRAS G12V (VVVGAVGVGK) Tetramer is assembled by biotinylated monomer and PE-labeled streptavidin.It contains Gly25-Thr305...
Keywords: CDABP0092
Expressed in: E.coli
Origin: human
From 1,071.00€ *
Show details
Review
PE-Labeled Human HLA-A*02:01&B2M&MART-1 (ELAGIGILTV) Tetramer Protein
PE-Labeled Human HLA-A*02:01&B2M&MART-1 (ELAGIGILTV)...

Item number: KT-MHC-HM435TP-100UG

KACTUS
Recombinant PE-Labeled Human HLA-A*02:01&B2M&MART-1 (ELAGIGILTV) Tetramer Protein is expressed from HEK293 with His tag and Avi tag at the C-terminus. PE-Labeled Human HLA-A*02:01&B2M&MART-1 (ELAGIGILTV) Tetramer is assembled by biotinylated monomer and PE-labeled streptavidin.It contains Gly25-Thr305(HLA-A*02:01),...
Keywords: CDABP0092
Expressed in: Human cells
Origin: human
From 1,071.00€ *
Show details
Review
PE-Labeled Human HLA-A*02:01&B2M&CMV pp65 (NLVPMVATV) Tetramer Protein
PE-Labeled Human HLA-A*02:01&B2M&CMV pp65 (NLVPMVATV)...

Item number: KT-MHC-HM458TP-100UG

KACTUS
Recombinant PE-Labeled Human HLA-A*02:01&B2M&CMV pp65 (NLVPMVATV) Tetramer Protein is expressed from HEK293 with His tag and Avi tag at the C-terminus. PE-Labeled Human HLA-A*02:01&B2M&CMV pp65 (NLVPMVATV) Tetramer is assembled by biotinylated monomer and PE-labeled streptavidin.It contains...
Keywords: CDABP0092
Expressed in: Human cells
Origin: human
From 1,071.00€ *
Show details
Review
Cytochrome C from equine heart
Cytochrome C from equine heart

Item number: LKT-C984782.1

LKT
Cytochrome C is a water-soluble heme protein. It has promising physiological function in mitochondrial respiration and apoptosis for cancer detection and control. It is well known as a model for protein folding studies.
Keywords: Cytochrome C, CYCS, CYC
Application: Water-soluble heme protein
CAS 9007-43-6
From 152.00€ *
Show details
Review
Human Laminin 511 Protein (Preclinical Grade)
Human Laminin 511 Protein (Preclinical Grade)

Item number: KT-LMN-HM511-100UG

KACTUS
Protein function: Binding to cells via a high affinity receptor, laminin is thought to mediate the attachment, migration and organization of cells into tissues during embryonic development by interacting with other extracellular matrix components. [The UniProt Consortium]
Keywords: LAMA5, KIAA0533, Laminin subunit alpha-5, Laminin-15 subunit alpha, Laminin-11 subunit alpha, Laminin-10 subunit alpha
84.00€ *
Show details
Review
B7-H3 (CD276), Avi-His-Tag HiP(TM)
B7-H3 (CD276), Avi-His-Tag HiP(TM)

Item number: BPS-79337-1

BPS
Human secreted CD276, known as Cluster of Differentiation 276 and B7-H3, GenBank Accession No. NM_001024736, a.a. 29466, with C-terminal Avi-His-Tag expressed in a HEK293 expression system. MW = 50 kDa.
Keywords: B7H3, B7-H3, CD276, PSEC0249, 4Ig-B7-H3, B7 homolog 3, CD276 antigen, Costimulatory molecule,
Application: Immunotherapy
Expressed in: human cells
Origin: human
MW: 50 kD
From 446.00€ *
Show details
Review
10593 from 10999 pages
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the usability of this website, serve for direct advertising or simplify interaction with other websites and social networks, will only be used with your consent. More information
Decline Accept all Configure