Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
Close filters
Filter by:
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
from to

Proteins and Enzymes

Proteins are found in every cell and form the basis of all biological processes. As molecular tools, they perform countless vital tasks in the body, for example by transporting metabolites, catalyzing chemical reactions, enabling cell movement or regulating gene expression. We offer a wide range of protein products, including enzymes, recombinant proteins and hormones. These products support researchers in molecular biology, cell biology, biochemistry and other scientific fields and can be used in a variety of applications, such as enzymatic assays, Western blots or protein-protein interaction studies.

Proteins are found in every cell and form the basis of all biological processes. As molecular tools, they perform countless vital tasks in the body, for example by transporting metabolites,... read more »
Close window
Proteins and Enzymes

Proteins are found in every cell and form the basis of all biological processes. As molecular tools, they perform countless vital tasks in the body, for example by transporting metabolites, catalyzing chemical reactions, enabling cell movement or regulating gene expression. We offer a wide range of protein products, including enzymes, recombinant proteins and hormones. These products support researchers in molecular biology, cell biology, biochemistry and other scientific fields and can be used in a variety of applications, such as enzymatic assays, Western blots or protein-protein interaction studies.

Filter
10592 from 10996 pages
No results were found for the filter!
RIGI PrEST Antigen
RIGI PrEST Antigen

Item number: ATA-APrEST95691.100

Atlas Antibodies
PrEST Antigen RIGI, Gene description: RNA sensor RIG-I, Alternative Gene Names: DDX58, DKFZp434J1111, FLJ13599, RIG-1, RIG-I, RIG1, Antigen sequence: CSTKGMMAGAEKLVECLLRSDKENWPKTLKLALEKERNKFSELWIVEKGIKDVETEDLEDKMETSDIQIFYQEDPECQNLSENSCPP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles....
Keywords: DDX58, RIG-I, RIG-1, RLR-1, EC=3.6.4.13, DEAD box protein 58, RIG-I-like receptor 1, Retinoic acid-inducible gene I...
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
KMT2C PrEST Antigen
KMT2C PrEST Antigen

Item number: ATA-APrEST95694.100

Atlas Antibodies
PrEST Antigen KMT2C, Gene description: lysine methyltransferase 2C, Alternative Gene Names: HALR, KIAA1506, MLL3, Antigen sequence: DTQLKEEYICMYCKHLGAEMDRLQPGEEVEIAELTTDYNNEMEVEGPEDQMVFSEQAANKDVNGQESTPGIVPDAVQVHTEEQQKSHPSESL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function:...
Keywords: HALR, KMT2C, Homologous to ALR protein, Lysine N-methyltransferase 2C, Histone-lysine N-methyltransferase 2C,...
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
ST6GALNAC6 PrEST Antigen
ST6GALNAC6 PrEST Antigen

Item number: ATA-APrEST95697.100

Atlas Antibodies
PrEST Antigen ST6GALNAC6, Gene description: ST6 N-acetylgalactosaminide alpha-2,6-sialyltransferase 6, Alternative Gene Names: SIAT7F, ST6GALNACVI, Antigen sequence: SSNSANEVFHYGSLRGRSRRPVNLKKWSITDGYVPILGNKTLP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Transfers the...
Keywords: SIAT7F, SIAT7-F, ST6GALNAC6, ST6GalNAcVI, ST6GalNAc VI, hST6GalNAc VI, Sialyltransferase 7F, GalNAc...
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
ZNF112 PrEST Antigen
ZNF112 PrEST Antigen

Item number: ATA-APrEST95699.100

Atlas Antibodies
PrEST Antigen ZNF112, Gene description: zinc finger protein 112, Alternative Gene Names: ZFP112, ZNF228, Antigen sequence: SVSWLSHHNDKLEVHRKENYSCHDCGEDIMKVSLLNQESIQTEEKPYPCTGYRKAFSNDSSSEVHQQFHLEGKPYTYSSCGKGC, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May be involved...
Keywords: ZNF112, ZFP112, Zfp-112, Zinc finger protein 112, Zinc finger protein 228
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
CSAD PrEST Antigen
CSAD PrEST Antigen

Item number: ATA-APrEST95706.100

Atlas Antibodies
PrEST Antigen CSAD, Gene description: cysteine sulfinic acid decarboxylase, Alternative Gene Names: CSD, PCAP, Antigen sequence: KECHYSIQKGAAFLGLGTDSVRVVKADERGKMVPEDLERQIGMAEAEGAVP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Catalyzes the decarboxylation of...
Keywords: CSD, CSAD, Aspartate 1-decarboxylase, Sulfinoalanine decarboxylase, Cysteine-sulfinate decarboxylase, Cysteine sulfinic...
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
JUND PrEST Antigen
JUND PrEST Antigen

Item number: ATA-APrEST95708.100

Atlas Antibodies
PrEST Antigen JUND, Gene description: JunD proto-oncogene, AP-1 transcription factor subunit, Alternative Gene Names: AP-1, Antigen sequence: AAGSMMKKDALTLSLSEQVAAALKPA, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Transcription factor binding AP-1 sites. [The UniProt...
Keywords: JUND, Transcription factor jun-D
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
HLA-DOA PrEST Antigen
HLA-DOA PrEST Antigen

Item number: ATA-APrEST95717.100

Atlas Antibodies
PrEST Antigen HLA-DOA, Gene description: major histocompatibility complex, class II, DO alpha, Alternative Gene Names: HLA-D0-alpha, HLA-DNA, HLA-DZA, Antigen sequence: ATKADHMGSYGPAFYQSYGASGQFTHEFDEEQLFSVDLKKSEAVWRLPEF, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function:...
Keywords: HLA-DOA, HLA-DNA, MHC DN-alpha, MHC DZ alpha, MHC class II antigen DOA, HLA class II histocompatibility antigen, DO alpha...
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
TAS2R10 PrEST Antigen
TAS2R10 PrEST Antigen

Item number: ATA-APrEST95727.100

Atlas Antibodies
PrEST Antigen TAS2R10, Gene description: taste 2 receptor member 10, Alternative Gene Names: T2R10, TRB2, Antigen sequence: FAYIAKILNDYKMKNDTVWDLNMYK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Gustducin-coupled strychnine receptor implicated in the perception of...
Keywords: TRB2, T2R10, TAS2R10, Taste receptor type 2 member 10, Taste receptor family B member 2
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
SPCS2 PrEST Antigen
SPCS2 PrEST Antigen

Item number: ATA-APrEST95732.100

Atlas Antibodies
PrEST Antigen SPCS2, Gene description: signal peptidase complex subunit 2, Alternative Gene Names: KIAA0102, Antigen sequence: EKSIFLVAHRKDPTGMDPDDIWQLSSSLKRFDDKYTLKL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Component of the microsomal signal peptidase complex...
Keywords: SPCS2, KIAA0102, EC=3.4.-.-, SPase 25 kDa subunit, Signal peptidase complex subunit 2, Microsomal signal peptidase 25 kDa...
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
FTCDNL1 PrEST Antigen
FTCDNL1 PrEST Antigen

Item number: ATA-APrEST95733.100

Atlas Antibodies
PrEST Antigen FTCDNL1, Gene description: formiminotransferase cyclodeaminase N-terminal like, Alternative Gene Names: FONG, Antigen sequence: HVPGCSVFLFGEADLPEKRSLVQRRKQLGWFTRRDFSALQPDLGAAPSQRCGLTACFRAL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Mouse gene identity: 26% Rat gene...
Keywords: FONG, FTCDNL1, Formiminotransferase-cyclodeaminase N-terminal-like protein, Formiminotransferase N-terminal...
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
STAM PrEST Antigen
STAM PrEST Antigen

Item number: ATA-APrEST95734.100

Atlas Antibodies
PrEST Antigen STAM, Gene description: signal transducing adaptor molecule, Alternative Gene Names: STAM1, Antigen sequence: YTKLMNEDPMYSMYAKLQNQPYYMQSSGVSGSQVYAGPPPSGAYLVAGNAQMSHLQSYSLPPEQLSSLSQAVVPPSANPALPSQQTQAAYPNTMVSSVQ, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function:...
Keywords: STAM, STAM1, STAM-1, Signal transducing adapter molecule 1
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
PLA2G4D PrEST Antigen
PLA2G4D PrEST Antigen

Item number: ATA-APrEST95740.100

Atlas Antibodies
PrEST Antigen PLA2G4D, Gene description: phospholipase A2 group IVD, Alternative Gene Names: cPLA2delta, Antigen sequence: VLKGSYEDTQTSFLGTASAFRFHYMAALETELSGRLRSSRSNGWNGDNSAGYLTVPLRPLTIGKEVTMDVPAPNAPGV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Calcium-dependent...
Keywords: cPLA2-delta, Phospholipase A2 group IVD, Cytosolic phospholipase A2 delta
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
10592 from 10996 pages
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the usability of this website, serve for direct advertising or simplify interaction with other websites and social networks, will only be used with your consent. More information
Decline Accept all Configure