Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
Close filters
Filter by:
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
from to

Proteins and Enzymes

Proteins are found in every cell and form the basis of all biological processes. As molecular tools, they perform countless vital tasks in the body, for example by transporting metabolites, catalyzing chemical reactions, enabling cell movement or regulating gene expression. We offer a wide range of protein products, including enzymes, recombinant proteins and hormones. These products support researchers in molecular biology, cell biology, biochemistry and other scientific fields and can be used in a variety of applications, such as enzymatic assays, Western blots or protein-protein interaction studies.

Proteins are found in every cell and form the basis of all biological processes. As molecular tools, they perform countless vital tasks in the body, for example by transporting metabolites,... read more »
Close window
Proteins and Enzymes

Proteins are found in every cell and form the basis of all biological processes. As molecular tools, they perform countless vital tasks in the body, for example by transporting metabolites, catalyzing chemical reactions, enabling cell movement or regulating gene expression. We offer a wide range of protein products, including enzymes, recombinant proteins and hormones. These products support researchers in molecular biology, cell biology, biochemistry and other scientific fields and can be used in a variety of applications, such as enzymatic assays, Western blots or protein-protein interaction studies.

Filter
10591 from 10998 pages
No results were found for the filter!
IFT27 PrEST Antigen
IFT27 PrEST Antigen

Item number: ATA-APrEST96144.100

Atlas Antibodies
PrEST Antigen IFT27, Gene description: intraflagellar transport 27, Alternative Gene Names: BBS19, FAP156, RABL4, RAYL, Antigen sequence: MVKLAAKCILAGDPAVGKTALAQIFRSDGAHFQKSYTLTTGMDLVVKTVPVPDTGDSVELFIFDSAGKELFSEMLDKLWESPNVLCLVYDV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein...
Keywords: RABL4, IFT27, Rab-like protein 4, Putative GTP-binding protein RAY-like, Intraflagellar transport protein 27 homolog
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
CCDC83 PrEST Antigen
CCDC83 PrEST Antigen

Item number: ATA-APrEST96147.100

Atlas Antibodies
PrEST Antigen CCDC83, Gene description: coiled-coil domain containing 83, Alternative Gene Names: CT148, FLJ42119, KP-CoT-23, MGC34732, Antigen sequence: AKLITSLQNDINTVKENAEKMSEHYKITLEDTRKKIIKETLLQLDQKKEWATQNAVKLIDKGSYLEIWENDWLKKEVAIHRKEVEEL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles....
Keywords: HSD9, CCDC83, Coiled-coil domain-containing protein 83
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
GP6 PrEST Antigen
GP6 PrEST Antigen

Item number: ATA-APrEST96149.100

Atlas Antibodies
PrEST Antigen GP6, Gene description: glycoprotein VI platelet, Alternative Gene Names: GPVI, Antigen sequence: ADPEIKRGSGWRPTGCSQPRVMFMTAEPQARSYPREGSWHGRRLKDWRVWSVEAGGQRLQLWKRGHAASSWCSIREPFGQCLSVCLP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Collagen receptor...
Keywords: GPVI, Glycoprotein 6, Platelet glycoprotein VI
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
ESX1 PrEST Antigen
ESX1 PrEST Antigen

Item number: ATA-APrEST96154.100

Atlas Antibodies
PrEST Antigen ESX1, Gene description: ESX homeobox 1, Alternative Gene Names: ESX1L, ESXR1, Antigen sequence: MESLRGYTHSDIGYRSLAVGEDIEEVNDEKLTVTSLMARGGEDEENTRSKPEYGTEAENNVGTEGSVPSDDQDR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May coordinately regulate cell cycle...
Keywords: ESX1, ESX1L
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
FAM228A PrEST Antigen
FAM228A PrEST Antigen

Item number: ATA-APrEST96157.100

Atlas Antibodies
PrEST Antigen FAM228A, Gene description: family with sequence similarity 228 member A, Alternative Gene Names: C2orf84, FLJ30851, Antigen sequence: FTFTSHCVIPKEWHKASARARSKTYKYSPEKLIYADKKQKRKEKKTADLSQAAFERQFLSSKLSQKNKVGERKGLVSRGLGRGWHAGLCSTHE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles....
Keywords: FAM228A, C2orf84, Protein FAM228A
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
MAPK9 PrEST Antigen
MAPK9 PrEST Antigen

Item number: ATA-APrEST96159.100

Atlas Antibodies
PrEST Antigen MAPK9, Gene description: mitogen-activated protein kinase 9, Alternative Gene Names: JNK2, p54a, PRKM9, SAPK, Antigen sequence: KDQPSDAAVSSNATPSQSSS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Serine/threonine-protein kinase involved in various processes...
Keywords: JNK2, MAPK9, JNK-55, MAPK 9, SAPK1a, MAP kinase 9, c-Jun N-terminal kinase 2, Mitogen-activated protein kinase 9,...
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
SLC20A1 PrEST Antigen
SLC20A1 PrEST Antigen

Item number: ATA-APrEST96161.100

Atlas Antibodies
PrEST Antigen SLC20A1, Gene description: solute carrier family 20 member 1, Alternative Gene Names: Glvr-1, GLVR1, PiT-1, PiT1, Antigen sequence: YTSYCNAVSDLHSASEIDMSVKAEMGLGDRKGSNGSLEEWYDQDKPEVS, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Sodium-phosphate symporter...
Keywords: GLVR1, PiT-1, GLVR-1, SLC20A1, Phosphate transporter 1, Solute carrier family 20 member 1, Leukemia virus receptor 1...
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
JUN PrEST Antigen
JUN PrEST Antigen

Item number: ATA-APrEST96167.100

Atlas Antibodies
PrEST Antigen JUN, Gene description: Jun proto-oncogene, AP-1 transcription factor subunit, Alternative Gene Names: AP-1, c-Jun, Antigen sequence: PTQFLCPKNVTDEQEGFAEGFVRALAELHSQNTLPSVTSAAQPVNGAGMVAPAVASVAGGSGSGGFSASLHSE, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function:...
Keywords: AP1, p39, JUN, Activator protein 1, Proto-oncogene c-Jun, Transcription factor AP-1, V-jun avian sarcoma virus 17 oncogene...
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
RFX5 PrEST Antigen
RFX5 PrEST Antigen

Item number: ATA-APrEST96170.100

Atlas Antibodies
PrEST Antigen RFX5, Gene description: regulatory factor X5, Antigen sequence: TVSKGGRGPGSQHTKEAEDKIPLVPSKVSVIKGSRSQKEAFPLAKGEVDTAPQGNKDLKEHVLQSSLSQEHKDP, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Activates transcription from class II MHC promoters. Recognizes...
Keywords: RFX5, Regulatory factor X 5, DNA-binding protein RFX5
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
COL1A2 PrEST Antigen
COL1A2 PrEST Antigen

Item number: ATA-APrEST96171.100

Atlas Antibodies
PrEST Antigen COL1A2, Gene description: collagen type I alpha 2 chain, Alternative Gene Names: OI4, Antigen sequence: GPPGVSGGGYDFGYDGDFYRADQPRSAPSLRPKDYEV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Type I collagen is a member of group I collagen (fibrillar forming...
Keywords: COL1A2, Alpha-2 type I collagen, Collagen alpha-2(I) chain
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
TFEB PrEST Antigen
TFEB PrEST Antigen

Item number: ATA-APrEST96174.100

Atlas Antibodies
PrEST Antigen TFEB, Gene description: transcription factor EB, Alternative Gene Names: bHLHe35, TCFEB, Antigen sequence: YHLQQSQHQKVREYLSETYGNKFAAHISPAQGSPKPPPAASPGVRAGHVLSSSAGNSAPN, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Transcription factor that acts as a master...
Keywords: BHLHE35, bHLHe35, Transcription factor EB, Class E basic helix-loop-helix protein 35
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
FAT3 PrEST Antigen
FAT3 PrEST Antigen

Item number: ATA-APrEST96175.100

Atlas Antibodies
PrEST Antigen FAT3, Gene description: FAT atypical cadherin 3, Alternative Gene Names: CDHF15, CDHR10, KIAA1989, Antigen sequence: PSFTQSQYSFTIAEDTAIGSTVDTLRILPSQNVWFSTVNGERPENNKGGVFVIEQETGTIKLDKRLDRETSPAFHFKVAATIPLDKVDIVFTVDV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein...
Keywords: FAT3, hFat3, CDHF15, Protocadherin Fat 3, Cadherin family member 15, FAT tumor suppressor homolog 3
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
10591 from 10998 pages
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the usability of this website, serve for direct advertising or simplify interaction with other websites and social networks, will only be used with your consent. More information
Decline Accept all Configure