Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
Close filters
Filter by:
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
  •  
from to

Proteins and Enzymes

Proteins are found in every cell and form the basis of all biological processes. As molecular tools, they perform countless vital tasks in the body, for example by transporting metabolites, catalyzing chemical reactions, enabling cell movement or regulating gene expression. We offer a wide range of protein products, including enzymes, recombinant proteins and hormones. These products support researchers in molecular biology, cell biology, biochemistry and other scientific fields and can be used in a variety of applications, such as enzymatic assays, Western blots or protein-protein interaction studies.

Proteins are found in every cell and form the basis of all biological processes. As molecular tools, they perform countless vital tasks in the body, for example by transporting metabolites,... read more »
Close window
Proteins and Enzymes

Proteins are found in every cell and form the basis of all biological processes. As molecular tools, they perform countless vital tasks in the body, for example by transporting metabolites, catalyzing chemical reactions, enabling cell movement or regulating gene expression. We offer a wide range of protein products, including enzymes, recombinant proteins and hormones. These products support researchers in molecular biology, cell biology, biochemistry and other scientific fields and can be used in a variety of applications, such as enzymatic assays, Western blots or protein-protein interaction studies.

Filter
10579 from 10996 pages
No results were found for the filter!
CFL1 PrEST Antigen
CFL1 PrEST Antigen

Item number: ATA-APrEST96198.100

Atlas Antibodies
PrEST Antigen CFL1, Gene description: cofilin 1, Alternative Gene Names: CFL, Antigen sequence: FWAPESAPLKSKMIYASSKDAIKKKL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Binds to F-actin and exhibits pH-sensitive F-actin depolymerizing activity (PubMed:11812157). In...
Keywords: p18, CFL, CFL1, Cofilin-1, 18 kDa phosphoprotein, Cofilin, non-muscle isoform
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
VSX1 PrEST Antigen
VSX1 PrEST Antigen

Item number: ATA-APrEST96208.100

Atlas Antibodies
PrEST Antigen VSX1, Gene description: visual system homeobox 1, Alternative Gene Names: PPCD, PPCD1, PPD, Antigen sequence: RQKRSDSVSTSDEDSQSEDRNDLKASPTLGKRTKRR, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Binds to the 37-bp core of the locus control region (LCR) of...
Keywords: RINX, VSX1, Visual system homeobox 1, Homeodomain protein RINX, Transcription factor VSX1, Retinal inner nuclear layer...
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
GPR157 PrEST Antigen
GPR157 PrEST Antigen

Item number: ATA-APrEST96217.100

Atlas Antibodies
PrEST Antigen GPR157, Gene description: G protein-coupled receptor 157, Alternative Gene Names: FLJ12132, Antigen sequence: VRKHINRAHTALSEYRPILSQEHRLLRHSSMADKK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Orphan receptor that promotes neuronal differentiation of radial...
Keywords: GPR157, G-protein coupled receptor 157
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
ZNF208 PrEST Antigen
ZNF208 PrEST Antigen

Item number: ATA-APrEST96218.100

Atlas Antibodies
PrEST Antigen ZNF208, Gene description: zinc finger protein 208, Alternative Gene Names: PMIDP, ZNF95, Antigen sequence: KVILRRYKIHHHACELGPIMNHHPTCGQMHI, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May be involved in transcriptional regulation. [The UniProt Consortium]...
Keywords: ZNF208, ZNF91L, Zinc finger protein 208, Zinc finger protein 91-like
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
CLDN20 PrEST Antigen
CLDN20 PrEST Antigen

Item number: ATA-APrEST96220.100

Atlas Antibodies
PrEST Antigen CLDN20, Gene description: claudin 20, Antigen sequence: WYTKEIIANFLDLTVPESNKHEPG, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion...
Keywords: CLDN20, Claudin-20
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
TEX264 PrEST Antigen
TEX264 PrEST Antigen

Item number: ATA-APrEST96222.100

Atlas Antibodies
PrEST Antigen TEX264, Gene description: testis expressed 264, ER-phagy receptor, Alternative Gene Names: FLJ13935, ZSIG11, Antigen sequence: PSPELIDLYQKFGFKVFSFPAPSHVVTATFPYTTILSIWLATRRVHPALDTYIKERKLCAYPRLEIYQEDQIHFMCPL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function:...
Keywords: Testis-expressed protein 264, Putative secreted protein Zsig11
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
SERPINA4 PrEST Antigen
SERPINA4 PrEST Antigen

Item number: ATA-APrEST96226.100

Atlas Antibodies
PrEST Antigen SERPINA4, Gene description: serpin family A member 4, Alternative Gene Names: KAL, KLST, KST, PI4, Antigen sequence: HGQLHVEHDGESCSNSSHQQILETGEGSPSLKIAPANADFAFRFYYLIASET, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Inhibits human amidolytic and...
Keywords: KST, PI-4, SERPINA4, Serpin A4, Kallistatin, Kallikrein inhibitor, Peptidase inhibitor 4
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
ARSI PrEST Antigen
ARSI PrEST Antigen

Item number: ATA-APrEST96233.100

Atlas Antibodies
PrEST Antigen ARSI, Gene description: arylsulfatase family member I, Alternative Gene Names: FLJ16069, SPG66, Antigen sequence: WAKPSFVADGPGEAGEQPSAAPPQPPHIIFILTDDQGYHDVGYHGSDIETPTLDRL, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Displays arylsulfatase activity at...
Keywords: ASI, ARSI, EC=3.1.6.-, Arylsulfatase I
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
ZNF20 PrEST Antigen
ZNF20 PrEST Antigen

Item number: ATA-APrEST96234.100

Atlas Antibodies
PrEST Antigen ZNF20, Gene description: zinc finger protein 20, Alternative Gene Names: KOX13, Antigen sequence: SYLDSFQSHDKACTKEKPYDGKECTET, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May be involved in transcriptional regulation. [The UniProt Consortium] Mouse gene...
Keywords: ZNF20, KOX13, Zinc finger protein 20, Zinc finger protein KOX13
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
ZDHHC15 PrEST Antigen
ZDHHC15 PrEST Antigen

Item number: ATA-APrEST96235.100

Atlas Antibodies
PrEST Antigen ZDHHC15, Gene description: zinc finger DHHC-type palmitoyltransferase 15, Alternative Gene Names: DHHC15, FLJ31812, MRX91, Antigen sequence: NEERPEVQKQMLVDMAKKLPVYTRTGSGAVRFCDRCHLIK, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: Palmitoyltransferase that...
Keywords: DHHC-15, Acyltransferase ZDHHC15, Palmitoyltransferase ZDHHC15, Zinc finger DHHC domain-containing protein 15
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
CENPJ PrEST Antigen
CENPJ PrEST Antigen

Item number: ATA-APrEST96236.100

Atlas Antibodies
PrEST Antigen CENPJ, Gene description: centromere protein J, Alternative Gene Names: BM032, CPAP, LAP, LIP1, MCPH6, Sas-4, SASS4, SCKL4, Antigen sequence: SNILSHEQSNFCRTAHGDFVLTSKRASPNLFSEAQYQEAPVEKNNLKEENRNHPTGESILCWEKVTEQIQEANDKNLQKHDDSSEVANIEERPIKAAIG, Storage: Upon delivery store at -20°C. Avoid repeated...
Keywords: CPAP, CENPJ, CENP-J, Centromere protein J, LAG-3-associated protein, LYST-interacting protein 1, Centrosomal...
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
CD83 PrEST Antigen
CD83 PrEST Antigen

Item number: ATA-APrEST95958.100

Atlas Antibodies
PrEST Antigen CD83, Gene description: CD83 molecule, Alternative Gene Names: BL11, HB15, Antigen sequence: KFARLQSIFPDFSKAGMERAFLPVTSPNKHLGLVTPQKTELV, Storage: Upon delivery store at -20°C. Avoid repeated freeze/thaw cycles. Protein function: May play a significant role in antigen presentation or the cellular...
Keywords: CD83, hCD83, CD83 antigen, B-cell activation protein, Cell surface protein HB15
Expressed in: E.coli
Origin: human
264.00€ *
Show details
Review
10579 from 10996 pages
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the usability of this website, serve for direct advertising or simplify interaction with other websites and social networks, will only be used with your consent. More information
Decline Accept all Configure