2019-Novel Coronavirus Nucleoprotein, Recombinant, aa1-419

2019-Novel Coronavirus Nucleoprotein, Recombinant, aa1-419
COVID-19 Research
Item number Size Datasheet Manual SDS Delivery time Quantity Price
544131.50 50 µg - -

3 - 19 business days*

365.00€
544131.100 100 µg - -

3 - 19 business days*

504.00€
 
On 31 December 2019, the World Health Organisation (WHO) was alerted of an outbreak of pneumonia... more
Product information "2019-Novel Coronavirus Nucleoprotein, Recombinant, aa1-419"
On 31 December 2019, the World Health Organisation (WHO) was alerted of an outbreak of pneumonia in Wuhan City, China, caused by an unknown virus. The virus was sequenced and identified as a novel strain of Coronavirus one week later on 7 January 2020. It belongs to the same family of viruses which include Severe Acute Respiratory Syndrome (SARS) and Middle Eastern Respiratory Syndrome (MERS)., 2019-nCoV is a positive-sense, single-stranded RNA virus which is thought to be of zoonotic origin. Symptoms of those infected include fever, dry cough, fatigue, shortness of breath and respiratory distress. Additionally, cases have resulted in renal failure, pneumonia and death. Those most seriously affected are individuals with already impaired immune systems, however approximately one quarter of otherwise well patients have required intensive care upon hospital admission., Human-to-human transmission of the virus has been confirmed, with previous Coronavirus outbreaks (such as SARS) originating from similar environments in Asian markets, where humans and live animals are in close proximity. Recombinant protein corresponding to aa1-419 from Nucleoprotein [2019-Novel Coronavirus], fused to His-Tag, expressed in E. coli. , Molecular Weight:, ~47.5kD, Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHGKE, DLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTGPEAGLPYGAN, KDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSR, NSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAEA, SKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGM, SRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADETQALP, QRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA, Storage and Stability: Lyophilized and reconstituted products may be stored at -20°C. Stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplier: United States Biological
Supplier-Nr: 544131

Properties

Application: ELISA, WB,
Conjugate: No
Host: E.coli
Species reactivity: SARS-CoV-2
Purity: >=95% (SDS-PAGE)
Format: Lyophilized

Handling & Safety

Storage: -20°C
Shipping: +4°C (International: °C)
Caution
Our products are for laboratory research use only: Not for administration to humans!
You will get a certificate here
or to request a certificate of analysis.
Read, write and discuss reviews... more
Customer review for "2019-Novel Coronavirus Nucleoprotein, Recombinant, aa1-419"
Write a review
or to review a product.
Viewed