Cookie preferences
This website uses cookies, which are necessary for the technical operation of the website and are always set. Other cookies, which increase the comfort when using this website, are used for direct advertising or to facilitate interaction with other websites and social networks, are only set with your consent.
Configuration
Technically required
These cookies are necessary for the basic functions of the shop.
"Allow all cookies" cookie
"Decline all cookies" cookie
CSRF token
Cookie preferences
Currency change
Customer-specific caching
FACT-Finder tracking
Individual prices
Selected shop
Session
Comfort functions
These cookies are used to make the shopping experience even more appealing, for example for the recognition of the visitor.
Note
Show the facebook fanpage in the right blod sidebar
Statistics & Tracking
Affiliate program
Conversion and usertracking via Google Tag Manager
Track device being used
COVID-19 Research
Item number | Size | Datasheet | Manual | SDS | Delivery time | Quantity | Price |
---|---|---|---|---|---|---|---|
544131.50 | 50 µg | - | - |
3 - 19 business days* |
356.00€
|
||
544131.100 | 100 µg | - | - |
3 - 19 business days* |
493.00€
|
On 31 December 2019, the World Health Organisation (WHO) was alerted of an outbreak of pneumonia... more
Product information "2019-Novel Coronavirus Nucleoprotein, Recombinant, aa1-419"
On 31 December 2019, the World Health Organisation (WHO) was alerted of an outbreak of pneumonia in Wuhan City, China, caused by an unknown virus. The virus was sequenced and identified as a novel strain of Coronavirus one week later on 7 January 2020. It belongs to the same family of viruses which include Severe Acute Respiratory Syndrome (SARS) and Middle Eastern Respiratory Syndrome (MERS)., 2019-nCoV is a positive-sense, single-stranded RNA virus which is thought to be of zoonotic origin. Symptoms of those infected include fever, dry cough, fatigue, shortness of breath and respiratory distress. Additionally, cases have resulted in renal failure, pneumonia and death. Those most seriously affected are individuals with already impaired immune systems, however approximately one quarter of otherwise well patients have required intensive care upon hospital admission., Human-to-human transmission of the virus has been confirmed, with previous Coronavirus outbreaks (such as SARS) originating from similar environments in Asian markets, where humans and live animals are in close proximity. Recombinant protein corresponding to aa1-419 from Nucleoprotein [2019-Novel Coronavirus], fused to His-Tag, expressed in E. coli. , Molecular Weight:, ~47.5kD, Applications: Suitable for use in ELISA and Western Blot. Other applications not tested. Recommended Dilution: Optimal dilutions to be determined by the researcher. AA Sequence: MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQGLPNNTASWFTALTQHGKE, DLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMKDLSPRWYFYYLGTGPEAGLPYGAN, KDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQLPQGTTLPKGFYAEGSRGGSQASSRSSSRSR, NSSRNSTPGSSRGTSPARMAGNGGDAALALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAEA, SKKPRQKRTATKAYNVTQAFGRRGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGM, SRIGMEVTPSGTWLTYTGAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADETQALP, QRQKKQQTVTLLPAADLDDFSKQLQQSMSSADSTQA, Storage and Stability: Lyophilized and reconstituted products may be stored at -20°C. Stable for 6 months after receipt at -20°C. Reconstitute with sterile ddH2O. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.
Supplier: | United States Biological |
Supplier-Nr: | 544131 |
Properties
Application: | ELISA, WB, |
Conjugate: | No |
Host: | E.coli |
Species reactivity: | SARS-CoV-2 |
Purity: | >=95% (SDS-PAGE) |
Format: | Lyophilized |
Database Information
KEGG ID : | K24149 | Matching products |
UniProt ID : | P0DTD1 | Matching products |
Gene ID | GeneID 43740578 | Matching products |
Handling & Safety
Storage: | -20°C |
Shipping: | +4°C (International: °C) |
Caution
Our products are for laboratory research use only: Not for administration to humans!
Our products are for laboratory research use only: Not for administration to humans!
Information about the product reference will follow.
more
You will get a certificate here
COVID-19 Research
COVID-19 Research
COVID-19 Research
COVID-19 Research
COVID-19 Research
COVID-19 Research
COVID-19 Research
Viewed