BOLA1, Recombinant, Human, aa1-137, His-Tag (BolA-like Protein 1)

Source:, Recombinant protein corresponding to aa1-137 from human BOLA1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~16.3kD, AA Sequence: MLSGRLVLGLVSMAGRVCLCQGSAGSGAIGPVEAAIRTKLEEALSPEVLELRNESGGHAVPPGSETHFRVAVVSSRFEGLSPLQRHRLVHAALAEELGGPVHALAIQARTPAQWRENSQLDTSPPCLGGNKKTLGTP, Storage and Stability: May be stored at 4°C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20°C. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap. Further dilutions can be made in assay buffer.