- Suchergebnis für K22066
Cookie-Einstellungen
Diese Website benutzt Cookies, die für den technischen Betrieb der Website erforderlich sind und stets gesetzt werden. Andere Cookies, die den Komfort bei Benutzung dieser Website erhöhen, der Direktwerbung dienen oder die Interaktion mit anderen Websites und sozialen Netzwerken vereinfachen sollen, werden nur mit Ihrer Zustimmung gesetzt.
Konfiguration
Technisch erforderlich
Diese Cookies sind für die Grundfunktionen des Shops notwendig.
"Alle Cookies ablehnen" Cookie
"Alle Cookies annehmen" Cookie
Ausgewählter Shop
CSRF-Token
Cookie-Einstellungen
FACT-Finder Tracking
Individuelle Preise
Kundenspezifisches Caching
Session
Währungswechsel
Komfortfunktionen
Diese Cookies werden genutzt um das Einkaufserlebnis noch ansprechender zu gestalten, beispielsweise für die Wiedererkennung des Besuchers.
Facebook-Seite in der rechten Blog - Sidebar anzeigen
Merkzettel
Statistik & Tracking
Endgeräteerkennung
Kauf- und Surfverhalten mit Google Tag Manager
Partnerprogramm
Zu "K22066" wurden 10 Artikel gefunden!
Filter schließen
Filtern nach:
Für die Filterung wurden keine Ergebnisse gefunden!
Artikelnummer: E-AB-18542.120
BOLA1 (BolA Family Member 1) is a Protein Coding gene. An important paralog of this gene is BOLA2. Protein function: Acts as a mitochondrial iron-sulfur (Fe-S) cluster assembly factor that facilitates (Fe-S) cluster insertion into a subset of mitochondrial proteins. Probably acts together with the monothiol...
Schlagworte: | Anti-hBolA, Anti-BolA-like protein 1, BOLA1 Polyclonal Antibody |
Anwendung: | IHC, ELISA |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse |
ab 71,00 €
Artikelnummer: E-AB-52476.120
BOLA1 (BolA Family Member 1) is a Protein Coding gene. An important paralog of this gene is BOLA2. Protein function: Acts as a mitochondrial iron-sulfur (Fe-S) cluster assembly factor that facilitates (Fe-S) cluster insertion into a subset of mitochondrial proteins. Probably acts together with the monothiol...
Schlagworte: | Anti-hBolA, Anti-BolA-like protein 1, BOLA1 Polyclonal Antibody |
Anwendung: | IHC, ELISA |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse |
ab 71,00 €
Artikelnummer: ATA-HPA007005.100
Protein function: Acts as a mitochondrial iron-sulfur (Fe-S) cluster assembly factor that facilitates (Fe-S) cluster insertion into a subset of mitochondrial proteins. Probably acts together with the monothiol glutaredoxin GLRX5 (PubMed:27532772). May protect cells against oxidative stress (PubMed:22746225). [The...
Schlagworte: | Anti-hBolA, Anti-BolA-like protein 1 |
Anwendung: | IHC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
ab 335,00 €
Artikelnummer: 349733.100
BOLA1 belongs to the bolA/yrbA family. BolA proteins (hBolA1, hBolA2, and hBolA3) are novel non-classical secreted proteins identified with bioinformatics and molecular biology experiments. The three BolA fusion proteins with c-Myc tag could be secreted into the culture medium of the transfected Cos-7 cells,...
Schlagworte: | hBolA, BolA-like protein 1 |
Ursprungsart: | human |
MW: | 14 kD |
ab 568,00 €
Artikelnummer: G-PACO08034.50
BOLA1 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human, Mouse, Rat and for use in ELISA, WB, IHC applications. BOLA1 Antibody is a high quality polyclonal antibody for research use only.. Protein function: Acts as a mitochondrial iron-sulfur (Fe-S) cluster assembly factor that...
Schlagworte: | Anti-hBolA, Anti-BolA-like protein 1 |
Anwendung: | ELISA, WB, IHC |
Wirt: | Rabbit |
Spezies-Reaktivität: | human, mouse, rat |
491,00 €
Artikelnummer: G-PACO25276.50
BOLA1 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA applications. BOLA1 Antibody is a high quality polyclonal antibody for research use only.. Protein function: Acts as a mitochondrial iron-sulfur (Fe-S) cluster assembly factor that facilitates (Fe-S)...
Schlagworte: | Anti-hBolA, Anti-BolA-like protein 1 |
Anwendung: | ELISA |
Wirt: | Rabbit |
Spezies-Reaktivität: | human |
363,00 €
Artikelnummer: ATA-APrEST70989.100
Protein function: Acts as a mitochondrial iron-sulfur (Fe-S) cluster assembly factor that facilitates (Fe-S) cluster insertion into a subset of mitochondrial proteins. Probably acts together with the monothiol glutaredoxin GLRX5 (PubMed:27532772). May protect cells against oxidative stress (PubMed:22746225). [The...
Schlagworte: | hBolA, BolA-like protein 1 |
Anwendung: | Control antigen |
Exprimiert in: | E.coli |
Ursprungsart: | human |
247,00 €
Artikelnummer: 372469.100
Source:, Recombinant protein corresponding to aa1-137 from human BOLA1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~16.3kD, AA Sequence: MLSGRLVLGLVSMAGRVCLCQGSAGSGAIGPVEAAIRTKLEEALSPEVLELRNESGGHAVPPGSETHFRVAVVSSRFEGLSPLQRHRLVHAALAEELGGPVHALAIQARTPAQWRENSQLDTSPPCLGGNKKTLGTP, Storage and...
Schlagworte: | hBolA, BolA-like protein 1 |
MW: | 16,3 |
ab 531,00 €
Artikelnummer: G-RPES4244.20
Human BOLA1 Recombinant Protein (RPES4244) is a highly pure recombinant protein developed by Assay Genie for use in a range of applications Protein function: Acts as a mitochondrial iron-sulfur (Fe-S) cluster assembly factor that facilitates (Fe-S) cluster insertion into a subset of mitochondrial proteins. Probably...
Schlagworte: | hBolA, BolA-like protein 1 |
Exprimiert in: | E.coli |
Ursprungsart: | human |
1.165,00 €
Artikelnummer: E-PKSH030568.100
Protein function: Acts as a mitochondrial iron-sulfur (Fe-S) cluster assembly factor that facilitates (Fe-S) cluster insertion into a subset of mitochondrial proteins. Probably acts together with the monothiol glutaredoxin GLRX5 (PubMed:27532772). May protect cells against oxidative stress (PubMed:22746225). [The...
Ursprungsart: | human |
1.016,00 €