Zu "K22066" wurden 10 Artikel gefunden!
Für die Filterung wurden keine Ergebnisse gefunden!
Anti-BOLA1
Artikelnummer: E-AB-18542.120
BOLA1 (BolA Family Member 1) is a Protein Coding gene. An important paralog of this gene is BOLA2. Protein function: Acts as a mitochondrial iron-sulfur (Fe-S) cluster assembly factor that facilitates (Fe-S) cluster insertion into a subset of mitochondrial proteins. Probably acts together with the monothiol...
| Schlagworte: | Anti-hBolA, Anti-BolA-like protein 1, BOLA1 Polyclonal Antibody |
| Anwendung: | IHC, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
ab 71,00 €
Anti-BOLA1
Artikelnummer: E-AB-52476.120
BOLA1 (BolA Family Member 1) is a Protein Coding gene. An important paralog of this gene is BOLA2. Protein function: Acts as a mitochondrial iron-sulfur (Fe-S) cluster assembly factor that facilitates (Fe-S) cluster insertion into a subset of mitochondrial proteins. Probably acts together with the monothiol...
| Schlagworte: | Anti-hBolA, Anti-BolA-like protein 1, BOLA1 Polyclonal Antibody |
| Anwendung: | IHC, ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse |
ab 71,00 €
Anti-BOLA1
Artikelnummer: ATA-HPA007005.100
Protein function: Acts as a mitochondrial iron-sulfur (Fe-S) cluster assembly factor that facilitates (Fe-S) cluster insertion into a subset of mitochondrial proteins. Probably acts together with the monothiol glutaredoxin GLRX5 (PubMed:27532772). May protect cells against oxidative stress (PubMed:22746225). [The...
| Schlagworte: | Anti-hBolA, Anti-BolA-like protein 1 |
| Anwendung: | IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
ab 335,00 €
BOLA1, Recombinant, Human, aa21-137, His-Tag (BolA-like...
Artikelnummer: 349733.100
BOLA1 belongs to the bolA/yrbA family. BolA proteins (hBolA1, hBolA2, and hBolA3) are novel non-classical secreted proteins identified with bioinformatics and molecular biology experiments. The three BolA fusion proteins with c-Myc tag could be secreted into the culture medium of the transfected Cos-7 cells,...
| Schlagworte: | hBolA, BolA-like protein 1 |
| Ursprungsart: | human |
| MW: | 14 kD |
ab 568,00 €
Anti-BOLA1
Artikelnummer: G-PACO08034.50
BOLA1 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human, Mouse, Rat and for use in ELISA, WB, IHC applications. BOLA1 Antibody is a high quality polyclonal antibody for research use only.. Protein function: Acts as a mitochondrial iron-sulfur (Fe-S) cluster assembly factor that...
| Schlagworte: | Anti-hBolA, Anti-BolA-like protein 1 |
| Anwendung: | ELISA, WB, IHC |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human, mouse, rat |
491,00 €
Anti-BOLA1
Artikelnummer: G-PACO25276.50
BOLA1 Antibody is a IgG polyclonal antibody from Assay Genie with reactivity against Human and for use in ELISA applications. BOLA1 Antibody is a high quality polyclonal antibody for research use only.. Protein function: Acts as a mitochondrial iron-sulfur (Fe-S) cluster assembly factor that facilitates (Fe-S)...
| Schlagworte: | Anti-hBolA, Anti-BolA-like protein 1 |
| Anwendung: | ELISA |
| Wirt: | Rabbit |
| Spezies-Reaktivität: | human |
363,00 €
BOLA1 PrEST Antigen
Artikelnummer: ATA-APrEST70989.100
Protein function: Acts as a mitochondrial iron-sulfur (Fe-S) cluster assembly factor that facilitates (Fe-S) cluster insertion into a subset of mitochondrial proteins. Probably acts together with the monothiol glutaredoxin GLRX5 (PubMed:27532772). May protect cells against oxidative stress (PubMed:22746225). [The...
| Schlagworte: | hBolA, BolA-like protein 1 |
| Anwendung: | Control antigen |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
247,00 €
BOLA1, Recombinant, Human, aa1-137, His-Tag (BolA-like...
Artikelnummer: 372469.100
Source:, Recombinant protein corresponding to aa1-137 from human BOLA1, fused to His-Tag at N-terminal, expressed in Yeast. Molecular Weight: ~16.3kD, AA Sequence: MLSGRLVLGLVSMAGRVCLCQGSAGSGAIGPVEAAIRTKLEEALSPEVLELRNESGGHAVPPGSETHFRVAVVSSRFEGLSPLQRHRLVHAALAEELGGPVHALAIQARTPAQWRENSQLDTSPPCLGGNKKTLGTP, Storage and...
| Schlagworte: | hBolA, BolA-like protein 1 |
| MW: | 16,3 |
ab 531,00 €
Recombinant Human BOLA1 Protein (His Tag) (RPES4244)
Artikelnummer: G-RPES4244.20
Human BOLA1 Recombinant Protein (RPES4244) is a highly pure recombinant protein developed by Assay Genie for use in a range of applications Protein function: Acts as a mitochondrial iron-sulfur (Fe-S) cluster assembly factor that facilitates (Fe-S) cluster insertion into a subset of mitochondrial proteins. Probably...
| Schlagworte: | hBolA, BolA-like protein 1 |
| Exprimiert in: | E.coli |
| Ursprungsart: | human |
1.165,00 €
Recombinant Human BOLA1 Protein (His tag)
Artikelnummer: E-PKSH030568.100
Protein function: Acts as a mitochondrial iron-sulfur (Fe-S) cluster assembly factor that facilitates (Fe-S) cluster insertion into a subset of mitochondrial proteins. Probably acts together with the monothiol glutaredoxin GLRX5 (PubMed:27532772). May protect cells against oxidative stress (PubMed:22746225). [The...
| Ursprungsart: | human |
1.016,00 €